KEGG   Synechococcus elongatus PCC6301: syc1827_dHelp
Entry
syc1827_d         CDS       T00163                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:syc00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1976902..1977432
Genome map
AA seq 176 aa AA seqDB search
MAILERTDWTAIAVALGSNLGNRVKHLQQAIAQLAALSSIRRLQVSPVYQTPPVGPPQPD
YYNACAIAETCLAPHDLLQQLQAIEAAAGRERLQHWGPRTLDLDLLLYGDRQIQTPDLTV
PHPYLTQRAFVLIPLAAIAPDWVEPVTGEAIATLAQRLDSTGIERLGSMEALAESP
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
gtggccattctagaaaggactgattggaccgccattgcagttgccctcggcagtaacttg
gggaaccgtgtcaagcaccttcagcaggcgatcgctcagcttgcagccttatctagcatt
cgccggctacaagtctcgccggtctaccaaacaccgccagttggccctccgcaaccggat
tactacaatgcttgcgcgatcgcagaaacctgtctggcaccacacgatctgttgcaacaa
ctgcaggcgatcgaagcggcggcaggacgggaacggttgcaacattgggggccgcgcaca
ttggacctcgatctgctgctctatggcgatcgccagattcaaacgcccgacttgacggtg
ccgcatccttacctgacccagcgagcttttgtcctgatccccctggctgcgatcgctcca
gattgggttgaacccgtcactggagaagcgatcgcgaccttggcgcaacggctggactca
actggaatcgagcgactcggtagcatggaagcgttggccgagagcccctaa

DBGET integrated database retrieval system