KEGG   Synechococcus elongatus PCC6301: syc1948_cHelp
Entry
syc1948_c         CDS       T00163                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:syc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    syc1948_c (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    syc1948_c (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    syc1948_c (trpB)
Enzymes [BR:syc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     syc1948_c (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(2088860..2090122)
Genome map
AA seq 420 aa AA seqDB search
MTQTPVNPSTTNAWANAIANLGERPDPLGRFGRFGGQYVPETLMPALAELEQAFARYSRD
PEFQAEFEGLLRDYVGRPNPLYFAERLTEYYRRPDGQGPNIYLKREDLNHTGAHKINNAL
GQALMAKRMGKKRIIAETGAGQHGVATATVCARFGLECVIYMGVHDMERQALNVFRMRLM
GAEVRGVAAGSGTLKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMIVREFHSMIGREV
RQQAQTLWGGLPDILLACVGGGSNAMGLFNEFVNEPSVRLIGVEAAGRGVDTPEHAATLT
KGRVGVLHGAMSYLLQDDDGQVIEAHSISAGLDYPGVGPEHSYLMDAGRAEYYSVTDDEA
LEAFQRISRLEGIIPALETAHAFAHLEKLCPTLSGNPNLVINCSGRGDKDVQTVAQRLQF
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
gtgacacaaacgccggtcaatccatccaccaccaacgcgtgggccaacgcgatcgcaaac
ttgggcgaacggcccgatccactagggcgctttggtcgctttggcggccaatacgtgccc
gaaaccctgatgccagccttggcagagctggaacaagcctttgctcgctatagccgcgac
cccgagtttcaagcggaatttgaaggactgctacgcgactacgtcggtcgccccaacccg
ctctacttcgccgagcgactgacggaatactaccgccgtcccgacggtcaaggccccaac
atctacctgaagcgcgaagacctcaaccacacgggcgcccacaaaattaacaatgccctg
ggtcaggctttgatggccaagcgcatgggcaaaaagcggatcattgcggaaaccggcgca
ggtcagcatggcgtagccacagcgacggtctgcgcccgctttggtctggagtgcgtgatc
tacatgggcgtccatgacatggagcgccaggctcttaacgtcttccggatgcgtttgatg
ggcgcggaagtgcggggtgtggcagcaggctctggaacgctcaaagatgccacttccgaa
gcaattcgcgactgggtgaccaacgtcgaaacgacgcactacatcctcggttcagtagca
ggcccgcacccctacccgatgatcgtgcgggagttccacagcatgattggccgcgaagtg
cgccagcaagcccagacactctggggcggcctgccagatattctgctggcctgtgttggc
ggtggctcgaatgccatgggtctgttcaacgagttcgttaatgagccttcggtgcgatta
attggcgtggaagctgccggtcgcggcgttgatacgccggaacatgccgccacgctgact
aaaggccgcgtcggcgtcctacatggagcgatgagctacctgctccaagatgacgatggg
caggtgatcgaagcccactcaatcagcgctggtctggactaccccggtgtgggccctgag
cacagctacctgatggatgcggggcgtgccgagtactacagcgtcaccgatgacgaagca
ctcgaagcgttccaacgaatttcgcgactggagggcatcattccggcgctggaaacagcc
cacgcttttgctcaccttgagaagctctgtccaaccttgagcggcaatcccaacttggtg
atcaactgctcgggacgtggcgataaagacgtacagacggtggcgcaaagactccagttt
taa

DBGET integrated database retrieval system