KEGG   Synechococcus elongatus PCC6301: syc1955_cHelp
Entry
syc1955_c         CDS       T00163                                 

Gene name
chlH
Definition
magnesium chelatase subunit H (EC:6.6.1.1)
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:syc00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(2096467..2100453)
Genome map
AA seq 1328 aa AA seqDB search
MFTQVKSAIRRIVPEDLNGRSRLKVVYVVLEAQYQSALSAAVRSINAGSHQVAVELSGYL
IEELRDPENYDAFKADLQDADIFIGSLIFIEDLAEKVVSAVQPVRDRLAASIVFPSMPEV
MRLNKLGSFSMAQLGQSKSVIASFMKKRKEAGGAGFQDAMLKLLRTLPNVLKYLPVEKAQ
DARNFMLSFQYWLGGSPENLENFLLMIADRYVFKKDSDVNVNFEEPVVYPDQGIWHPLAP
QMFEDLKEYLNWYQSRQDLPKQDGPTIGLVLQRSHLVTGDDAHYVAVVSEMEYRGAKVIP
VFNGGLDFSKPVQQYFFDPLDPETPIIDATVSLTGFALVGGPARQDHPKAIETLKKLNRP
YMVALPLVFQTTEEWEESDLGLHPVQVALQIAIPELDGAIEPIIMSGRDSATGKAHTLQD
RVEMIAERSIRWANLRRTPRATKKLAITVFSFPPDKGNVGTAAYLDVFGSIHRVMEELKA
AGYTVEGMPKTAKELMEEVIHDAQAQYASPELNIAYRMSVSEYQRLTPYAERLEENWGPP
PGQLNSDGENLLIFGKQFGNVFIGVQPTFGYEGDPMMLLYSRSASPHHGFAAYYTYLNHI
WGANAVLHFGTHGSLEFMPGKQMGMSGACYPDNLIGTIPNLYYYAANNPSEATIAKRRGY
AETISYLTPPAENAGLYKGLKELSELVGSYQTLRESGRGVAICNSIVETCRQVNLDQDVE
LPDVDAAELSADDRDRLVGNVYRKLMEIESRLLPCGLHVIGKPPTAEEAIATLVNIASLD
RDEEGITGLPTLIARSLGREMEEIFRSADLGVLDDVNLNQSITEAVRASVAAMVREVTGS
DGRVSLVKRFGWIEKLLAFFNIKLKPAYQRALEAKGYKVDEDALKVLFDYLQFCLEQVCA
DLEMQNLVKALDGEYVMPAPGGDPIRNPNVLPSGRNIHALDPQSIPTTAAVQSAKVVVDR
LLDRQRAENDGNWPETIACVLWGTDNIKTYGESLAQILWFVGVKPKPDSLGRVNKLELIP
LEELGRPRVDVVVNCSGVFRDLFINQMALIDQAVKMAAEADEPLEMNFVRKHSLEQAKKL
NIELRQAASRVFSNASGSYSSNVNLAIENSSWEEESELQNMYLERKSFAFDSDNPGMMNQ
NQELFRESLKTADVTFQNLDSSEISLTDVSHYFDSDPTKLVASLREDGKKPASFIADTTT
ANAQVRTLNETVRLDSRTKLLNPKWYEGMLNSGYEGVREIAKRLNYTSGWSATAGAVDNW
VYEEANTTFISDPEMQKRLMDLNPHSFRRMVGTLLEVAGRGYWETSDENIQRLQELYQEV
EDRIEGVE
NT seq 3987 nt NT seq  +upstreamnt  +downstreamnt
atgttcacccaggtcaagtccgcaatccgtcgcatcgtgcccgaggaccttaacgggcga
tcgcggctgaaagtggtctacgtcgtcttggaagcgcagtatcagagtgcgctctcggcc
gccgtccgatcgatcaatgctggctcccatcaagttgctgttgaactgagcggctacctg
atcgaagaactgcgcgatcccgaaaactacgacgcctttaaagccgatctgcaggatgca
gatatcttcatcggctcgctgatcttcatcgaagacctagctgagaaagtggtcagcgcc
gtgcaaccggtgcgcgatcgccttgccgcctcgatcgtcttcccctcgatgccggaggtg
atgcgcctcaacaagctcggctccttctcgatggcgcagctgggccaaagcaagagcgtg
atcgccagcttcatgaagaagcgcaaggaagcgggtggagcaggtttccaagacgccatg
ctcaagctgctgcgtaccctgccgaacgtcctcaagtacctgccggttgagaaggcacag
gacgctcgcaacttcatgcttagcttccagtactggctggggggttcgccagagaacctg
gaaaacttcctgttgatgattgccgatcgctacgtcttcaaaaaagacagcgacgtcaac
gtcaactttgaagagccagtcgtttaccccgaccaaggcatctggcacccgctggcaccc
cagatgtttgaggacttgaaggagtacctcaactggtatcagtcgcgccaagacctgccc
aagcaagatggtccaaccatcggcctggtgctgcagcgcagccacttggtcaccggcgac
gatgcgcactacgtggcggtcgtttccgagatggaatatcgcggtgccaaagtgattccc
gtcttcaacggcgggctggacttttcgaagccggtgcagcagtacttcttcgatcccctc
gatcccgagacaccgatcatcgacgcaaccgtctcgctgaccggctttgcgctggtgggt
ggccctgcgcgccaagaccatcccaaggcgatcgaaaccctcaaaaagctgaatcgtccc
tacatggtggcgctgccgctggtcttccaaaccacggaagagtgggaagagagcgacctc
ggtttgcaccccgtgcaagtggcgctgcaaatcgccattcctgagctagacggcgcgatc
gagccgatcattatgtctggccgcgatagcgccaccggcaaagcccacaccctgcaagat
cgggtcgagatgatcgcagagcgatcgatccgctgggccaacctgcgccgcacgcctcgc
gccactaaaaagctggcgatcaccgtcttcagcttcccgccggataagggcaacgttggt
acggcggcctatctggacgtgttcggctcgatccatcgcgtcatggaagagctgaaagcg
gcaggctacaccgtggaagggatgccgaagaccgccaaggagttgatggaggaagtcatc
cacgacgcccaagcccaatacgcctcgccggaactgaacatcgcctaccgcatgtcggtg
agcgaataccagcggctgacgccctacgcggaacgcctcgaagaaaactgggggccacct
ccgggacagctgaacagcgacggcgaaaacctgctgatcttcggtaagcagtttggcaac
gtcttcatcggcgtccagccgaccttcggttacgaaggcgacccgatgatgctgctctac
agccggagcgctagccctcaccacggctttgctgcctattacacctacctcaaccacatt
tggggggcgaacgcggtgctgcacttcggcacccacggctcgctggagttcatgcctggt
aagcagatgggcatgagcggtgcctgctaccccgacaacttgatcggcacgatccccaac
ctctactactacgcggcgaacaacccctcagaagccacgatcgccaaacgacggggctat
gccgaaacgatcagctacctgaccccacccgctgaaaacgcgggtctctacaagggtctg
aaggaactgagcgagctggtgggcagctaccaaaccctgcgggaaagtggccgcggtgtc
gccatctgcaactcgattgtggaaacctgccgtcaggtcaacctcgaccaagacgtcgaa
ctaccggacgttgatgccgcagaactgagcgccgacgatcgcgatcgcctagtgggcaac
gtctaccgcaagctgatggaaatcgagagccgtctgctgccctgcggtctgcacgtgatt
ggcaaaccgccaactgccgaagaagcgatcgccaccctcgtcaacatcgccagcctcgat
cgcgatgaagaagggatcaccggcctaccgaccttgattgcccgcagcctcggtcgcgag
atggaagaaatcttccgcagcgctgatctgggcgtgctggatgacgtcaacctcaaccag
tcgatcaccgaagcggttcgtgcttcagtggcagcgatggtgcgggaagtcaccggcagt
gatggccgtgtctcgctggtcaaacgctttggctggatcgaaaagctgctggctttcttc
aacatcaaactgaaaccggcctaccaacgggctttggaagccaagggctacaaggttgat
gaggatgcgctgaaagtcctgttcgactatctgcaattctgcttggagcaagtctgcgcc
gacttggaaatgcagaacctcgtcaaggcgctggacggcgaatatgtgatgcccgcgccg
ggtggcgacccgattcgtaaccccaacgtgctgccgtccggtcgcaacattcacgcgctg
gatccccagtcgattccgacgaccgcagcggtgcaatcggccaaagtcgtggtcgatcgc
ctgctcgatcgccagcgggcagaaaatgacggcaactggccagaaacaatcgcctgcgtt
ctctggggcaccgacaacatcaagacctacggcgagtcgctggcgcaaatcctctggttt
gtcggcgtcaagccgaagccggacagcctcggtcgcgtcaacaagctggagctgattccg
ctggaagagctgggtcgtccccgcgtcgatgtggtcgtcaactgttcgggcgtgttccgc
gatctgttcatcaaccaaatggcgctgatcgaccaagcggtgaaaatggctgccgaagct
gatgagccgctggagatgaactttgtgcgcaagcactcgctggagcaagccaagaagctg
aacattgagctgcgccaagcggcaagccgtgtcttctccaacgcttccggtagctacagc
agcaacgtcaacttggcgatcgagaacagcagctgggaagaggaaagcgaactccagaac
atgtatctggagcgtaaatccttcgcgtttgatagcgacaaccccggcatgatgaaccaa
aatcaggaactgttccgggaatcgctgaagacagcggatgttaccttccagaacttggat
tcgtcggaaatttcgctgacggatgtgagccactacttcgacagcgacccgaccaagttg
gtggcgagcctgcgggaagacggcaagaaaccggcgagcttcattgccgacacgaccacg
gcgaatgcccaagtgcggacgctaaatgaaacggtgcggctggactcgcggacgaagctg
ctcaatcccaagtggtacgaagggatgctgaacagcggttatgaaggcgtgcgggaaatt
gctaagcgcttgaactacacttcgggctggtcagcgacggcgggcgcggttgataactgg
gtctatgaggaggcgaatacgaccttcatttctgatccggaaatgcagaagcgcctgatg
gatctcaacccccacagcttccgccgcatggtgggcacgctactagaggttgcaggtcgc
ggctactgggaaaccagtgacgaaaatatccaacgcctgcaagagctctatcaagaggtc
gaagaccgaatcgaaggcgtcgaataa

DBGET integrated database retrieval system