KEGG   Synechococcus elongatus PCC6301: syc1981_cHelp
Entry
syc1981_c         CDS       T00163                                 

Gene name
xylR
Definition
xylose repressor
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:syc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    syc1981_c (xylR)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    syc1981_c (xylR)
   00052 Galactose metabolism
    syc1981_c (xylR)
   00500 Starch and sucrose metabolism
    syc1981_c (xylR)
   00520 Amino sugar and nucleotide sugar metabolism
    syc1981_c (xylR)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    syc1981_c (xylR)
   00524 Butirosin and neomycin biosynthesis
    syc1981_c (xylR)
Enzymes [BR:syc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     syc1981_c (xylR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(2124098..2125006)
Genome map
AA seq 302 aa AA seqDB search
MAYPATVIGVDLGGTAMKLGRYPIEGQCQQELTVPTPTPSTPSNVRAALVEAIRQLDPQA
EALAIGIGTPGPADAAGRVARVAINLDGWTEVPLADWLEADLQRPVILANDANCAGLGEV
WLGGGRGYRDAILLTLGTGVGGAIVLNGELFVGRTGTAAELGLITLDPAGPHCNSGNQGS
LEQYASIGAVQRRFGCDPKDLGDRASQGGPEAIAAWQDYGRTLAAGLASLVYVLTPEVII
LGGGISGSAAFFLPALTEELHRRVLPTSREDLQIAIAALGNEAGRVGAAKLAWDKLQALG
KV
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggcataccccgcgaccgtgatcggcgtcgatttgggcggaactgccatgaaattgggg
cgttacccgattgagggacagtgtcagcaggaattgaccgtcccaactccaacccccagc
acgccaagcaatgttcgggctgcgctcgtagaggcgatccgtcagctcgatccccaagct
gaagcactggcgatcggcattggtacaccggggcctgcggatgcagccggtcgggtagcg
cgggttgccatcaatctagacggctggactgaggtccccctggctgactggctggaagcc
gatctgcaacggccggtcattttggccaatgatgccaactgcgctggcttgggtgaagtc
tggctgggtggcggtcggggctatcgcgatgccattttgctgactctcgggaccggcgtg
ggcggggcgatcgtactcaatggcgagctgtttgtgggtcgcacgggaacagcagcagaa
ctcgggctgatcacactggacccggctgggccgcattgcaatagtggcaaccaaggatcg
ttagagcaatatgcctcgatcggagccgttcagcggcgctttggttgcgatcccaaagac
ctcggcgatcgcgcttcccaagggggtcctgaagcgatcgcggcttggcaggactatggc
cgaacgctcgctgccggtcttgccagtctggtctatgtcctgacgcccgaagtgattatt
ctgggcggcggcatcagcggcagtgcagctttcttcttaccggcactgacggaggagctg
catcgtcgcgtcctcccgacctctcgtgaagatctgcagattgcgatcgcggcactcggc
aacgaagccggtcgagttggggctgccaagttggcttgggacaagctacaagcactgggc
aaggtctga

DBGET integrated database retrieval system