KEGG   Synechococcus elongatus PCC6301: syc2130_cHelp
Entry
syc2130_c         CDS       T00163                                 

Gene name
ppx
Definition
exopolyphosphatase
Orthology
K01524  
exopolyphosphatase / guanosine-5'-triphosphate,3'-diphosphate pyrophosphatase [EC:3.6.1.11 3.6.1.40]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:syc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    syc2130_c (ppx)
Enzymes [BR:syc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.11  exopolyphosphatase
     syc2130_c (ppx)
    3.6.1.40  guanosine-5'-triphosphate,3'-diphosphate phosphatase
     syc2130_c (ppx)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(2279658..2281358)
Genome map
AA seq 566 aa AA seqDB search
MRPPLHGRLGLAWNPAPMSTEIAPHARPALPSELGPEPILAAIDVGTNSIHMVVVQIRPD
LPAFDIVGTEKATVRLGDRDPATGELTEAAMERALQALQRCRAIAAARGATQIVAVATSA
VREAPNGRQFLERVIHEVGLEVDLISGPEEARRIYLGVLSGMDFQQRHHAIIDIGGGSTE
LILGAGQEPLCLTSTKVGAVRLTQEFIHTDPISPSEYTVLQAYVRGMVERAVDEVKAALP
PNTPLRLIGTSGTIQALAALHAHQSQGSLPTTFNGYSLALGDLQQLVQQLRRMPFAERQT
LPELSERRAEIIVAGAIVLQETMQLLGCDRVTICERALREGLIVDWMLSHGLIEDKLRYQ
GSVRQRSVYNQARKFRVDVSHGEQVAQLALSLFDQLRGQLHQWGESERELLWAAAILHNC
GHHIDHSSHHKHSYYLIRHGGLLGYNETEIELIANLARYHRKSLPKKKHENFRTLPTKEQ
RRLVEQLSAILRAAVALDRRQVGAIASLHCRYLAPQRQLLLQLHPARTSEDCALELWSFD
YNRHALEAAFAINVAAELVPQPLSAV
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
gtgaggcccccgctgcatggcagactaggcctagcttggaaccctgcgcccatgagcacc
gagattgcgccccacgcccgtccagcactccccagtgagctcgggccagaaccgattttg
gcagcaatcgatgtgggcacaaactccattcacatggtggtggtccagattcgtcccgac
ctgccggccttcgatatcgtcggcaccgagaaagccaccgtccgactgggcgatcgcgat
cctgccacgggtgagttgaccgaggcggcgatggaacgggcactccaagcgctgcaacgc
tgtcgagcgatcgcggcggctcggggggccacgcaaattgtggctgtcgccaccagtgct
gtgcgagaggctcccaatggtcgccaatttctcgagcgggtcatccatgaagtcggttta
gaagtcgatctgatctcggggccagaggaagcacgacgcatctaccttggggtgctgtcc
ggcatggattttcagcagcgacaccacgccatcattgatattggcggtggatcgaccgag
ctgattctgggagcggggcaagagccgctctgcctgaccagcacgaaggttggcgccgtc
cgtctcacccaagaattcattcacaccgacccaattagccccagcgagtacaccgtgctg
caagcctacgtgcgcggcatggtcgaacgggcggtcgatgaagtcaaagccgctctacca
cccaacacgcccctacgactgatcggcacttccggcaccattcaagccctcgccgccctc
catgcccaccaaagccaaggcagcttgccgaccaccttcaatggctacagcttagctctt
ggcgatctgcagcagttggtgcagcagttgcggcgtatgccctttgccgaacgtcagact
ttgcccgagctgtcggaacgacgagctgagattatcgttgcaggggcgatcgtgctgcag
gaaaccatgcagctgttgggttgcgatcgcgtcaccatctgcgaacgggccttgcgcgag
gggctgatcgtcgactggatgctcagccacggactgatcgaagacaagctgcgctatcag
ggatcggtgcggcagcgcagtgtctacaaccaagcgcgcaaatttcgggtagatgtcagt
cacggcgagcaagtggcgcaattagccctcagcctgtttgaccaactgcgcggacaacta
caccaatggggcgagagcgaacgggaactcctttgggcagccgccatcctgcacaattgc
ggccatcacatcgaccactcctcccatcacaagcattcctattacctgatccgccacggg
ggtctgctgggctacaacgagacggagattgaactgattgctaatctggctcgctatcac
cgcaagagcctgcccaagaaaaagcacgaaaacttccgcaccctgcccaccaaggagcaa
cggcgcttggtagaacaactcagcgcgattctgcgggcggcagttgccctcgatcgccgg
caggtaggagcgatcgcgagtcttcattgccgctaccttgctccgcaacggcagcttctt
cttcaactgcatccggctcgaaccagtgaggactgcgccctcgaactctggagttttgac
tacaaccgccatgctttagaagccgcgtttgcaatcaatgtcgccgcagaactggtgccg
cagccgctcagcgcagtctag

DBGET integrated database retrieval system