KEGG   Synechococcus elongatus PCC6301: syc2311_dHelp
Entry
syc2311_d         CDS       T00163                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:syc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    syc2311_d (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    syc2311_d (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    syc2311_d (thrC)
Enzymes [BR:syc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     syc2311_d (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2467930..2469222
Genome map
AA seq 430 aa AA seqDB search
MTQTTLSTSTVKALKCKECGHEYDLGAKHVCEDVCFGPLEVVYDYDAIRQRVSRATIEAG
PNSIWRYRHFLPVTGEDVIDVGTGMTPLVEAKRLARRLGLKKLFIKNDAVNMPTLSFKDR
VVSVALTRARELGFSTVSCASTGNLANSTAAIAAHAGLDCCVFIPADLEAGKVLGTLIYN
PTLMAVKGNYDQVNRLCSEVANTHGWGFVNINLRPYYSEGSKTLGYEVAEQLGWQLPDHI
VAPLASGSLFTKIYKGFREFVDVGLVDDKAVRFSGAQAEGCSPIAKAFHEGRDFIAPEKP
NTIAKSIAIGNPADGIYAVEIARKTGGNIEAVNDTEIIEGIKLLAETEGIFTETAGGTTV
AVLKKLVEAGKINPDETTVVYITGNGLKTQEAVQGYIAEPFTIEPKLESFEHALERSRTL
DRLEWQQVLI
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgacccaaacgacactcagcaccagcaccgtgaaggcactcaagtgtaaagagtgcggt
catgagtatgacctgggtgccaagcacgtttgtgaagatgtctgtttcggcccgctggaa
gtggtctatgactacgacgccattcgccaacgcgtcagtcgcgccaccattgaagcgggc
cctaactcaatttggcgctatcgtcacttcctgcctgttactggcgaagacgtcattgac
gttggcaccggcatgacccctttggttgaagccaaacgcttggctcgccgcttgggtctg
aaaaagcttttcatcaaaaacgatgcggtcaacatgccgaccttgagcttcaaggatcgg
gtcgtttccgtggcgctgacccgtgcgcgtgagcttggcttcagcactgtttcctgcgct
agcaccggcaacctcgctaactcaacggccgcgatcgcggctcatgccggtctggactgc
tgcgtcttcattcctgctgatctggaagccggtaaagtcctcggcaccttgatctataac
ccgaccttgatggcggtcaaaggcaactacgaccaagtcaaccgcctctgctccgaagtc
gctaacacccacggctggggcttcgtcaacatcaacctgcgcccctactactcggaaggc
tcgaaaacgctgggctacgaagtggctgagcaactgggctggcaactgccggatcacatt
gtggcgccgctggcttcgggctcgctgttcaccaaaatctacaaaggcttccgcgaattc
gtcgatgtcggtcttgtcgatgacaaagccgtgcgcttcagcggtgctcaagccgaaggt
tgctcgccgatcgccaaagctttccatgaaggtcgcgactttatcgcccctgaaaaaccc
aacacgatcgctaaatcgatcgcgatcggcaaccctgctgacggcatctatgcggttgaa
attgctcgcaaaaccggcggcaacatcgaagcagtcaatgacaccgagatcatcgaaggc
atcaagctactggccgagaccgaaggcatctttaccgaaactgctggcggtaccaccgtc
gctgtgctcaagaaattggtggaagcaggcaaaatcaatcctgatgaaaccacggtggtc
tacatcaccggcaacggtctgaagacccaagaagccgttcagggctacattgctgagccg
ttcacgattgagccgaaactggaaagcttcgagcatgcgctagagcgctctcggaccctc
gatcgcttggaatggcagcaagtgctgatctag

DBGET integrated database retrieval system