KEGG   Synechococcus elongatus PCC6301: syc2345_dHelp
Entry
syc2345_d         CDS       T00163                                 

Gene name
rpoD2
Definition
group2 RNA polymerase sigma factor RpoD2
Orthology
K03087  
RNA polymerase nonessential primary-like sigma factor
Organism
syc  Synechococcus elongatus PCC6301
Brite
Transcription machinery [BR:syc03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     syc2345_d (rpoD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2499488..2500450
Genome map
AA seq 320 aa AA seqDB search
MSTSSAQYSPDLVRAYLQEIGRVRLLTAEEELCFGRQVQRLMMLLDAQTELRDRLGHEPS
KEEWAAAVDLNLEDLDRQIEQGQRAKRKMIEANLRLVVSIAKKYQKRHMEFLDLIQEGTL
GLERGFEKFDPSKGYKFSTYAYWWIRQAITRAIAQQSRTIRLPIHITEKLNKLKKTQREL
SQQLGRSATASELAEVLELPLEQVREYIQMNRQPVSLDVKVGDSQDTELQELLEDEQSSP
SDYVEQESLRRDLRNLMAELTPQQQAVIALRYGLDEGDSLSLAKVGERLNISRERVRKLE
RQAMDHLRRRSRLLAEYAAS
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgtctacctcctccgctcaatacagtcctgatttagtccgtgcttacctgcaagaaatt
ggccgggtgcggctgctgaccgctgaagaagagttgtgctttggccgacaggttcagcgc
ctgatgatgctcttggatgctcaaaccgagctgcgcgatcgcttggggcatgagcctagc
aaagaagaatgggctgctgctgttgacctgaatctcgaagatctcgatcgccaaattgag
caaggtcagcgggcgaaacgcaaaatgattgaggccaacctgcgcctcgttgtttcgatc
gccaagaaataccagaagcgtcacatggaattcttggatctcatccaagaaggcacactg
gggctggagcgtggtttcgaaaaattcgatccctccaaaggctacaagttctctacctac
gcctactggtggattcgccaagctattacccgtgcgatcgcccaacaatcccgcacgatt
cgtctgcctattcacatcactgaaaagctgaacaagctcaaaaaaacccagcgcgaactc
tcgcagcaattgggccgcagtgccacagcttcagagctggcagaagtgctggagctgcca
ctggagcaggtgcgggaatacatccaaatgaaccgccagccagtatcgctcgatgtcaaa
gtaggtgacagccaagacactgaattgcaggaactgctggaagacgagcagtcttcgccc
tcagattacgtggaacaagaatcgctacgccgcgatctacgcaatttaatggcagaactg
accccccagcaacaggccgtgattgccctgcgctacggcttggatgaaggtgacagtctg
tcgttggccaaagtcggcgaacgcctgaatatcagccgcgaacgcgtgcggaaactagag
cgccaagccatggatcacctacgtcgccgcagtcgtcttctggcggaatacgcagctagc
tag

DBGET integrated database retrieval system