KEGG   Synechococcus elongatus PCC6301: syc2349_cHelp
Entry
syc2349_c         CDS       T00163                                 

Gene name
gap2
Definition
(GenBank) glyceraldehyde 3-phosphate dehydrogenase
  KO
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
Glycolysis / Gluconeogenesis
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:syc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    syc2349_c (gap2)
   01230 Biosynthesis of amino acids
    syc2349_c (gap2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    syc2349_c (gap2)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    syc2349_c (gap2)
Enzymes [BR:syc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     syc2349_c (gap2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2503217..2504236)
Genome map
AA seq 339 aa AA seqDB search
MTIRVAINGFGRIGRNFLRCWFGRQNTDLEVVAINNTSDARTAAHLLEYDSVLGRFNADI
SYDENSITVNGKTMKIVCDRNPLNLPWKEWDIDLVIESTGVFVTAEGASKHIQAGAKKVP
ITAPGKGEGVGTYVIGVNDSEYRHEDFAVISNASCTTNCLAPVAKVLHDNFGIIKGTMTT
THSYTLDQRILDASHRDLRRARAAAVNIVPTTTGAAKAVALVIPELKGKLNGIALRVPTP
NVSVVDLVVQVEKPTITEQVNEVLQKASQTTMKGIIKYSDLPLVSSDFRGTDESSIVDSS
LTLVMDGDLVKVIAWYDNEWGYSQRVVDLAELAARKWAA
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtgacgattcgagttgcgatcaatggctttggccgtattggccggaattttctccgttgc
tggtttggacggcagaacaccgatctagaggttgtggccattaacaacacctcggatgca
cggacggctgctcacctgctggagtacgactctgttctcggccggttcaacgccgacatc
agctacgacgaaaattcgatcaccgtcaacggcaagacgatgaaaatcgtctgcgatcgc
aaccccctcaacctgccttggaaagagtgggatatcgatctcgtcattgaatctacaggt
gtgttcgtcaccgctgaaggcgcatccaagcacatccaagccggggccaagaaagttccg
atcacggctcctggtaaaggcgaaggtgtcggcacctacgtcatcggtgtcaacgattcg
gaataccgccacgaagacttcgcagtcatcagcaatgcaagctgcaccaccaactgctta
gcaccggtcgccaaagttctgcatgacaactttggcatcatcaaaggcacgatgaccacc
acccacagctacacgctggaccagcgcatcttggacgccagccaccgtgatctacgtcgg
gctcgggctgcagccgttaacatcgttcccaccacgaccggcgctgctaaagccgttgct
ttggtgatccccgagctgaaaggcaaactaaacgggattgcgctgcgcgttcctacgcca
aacgtgtctgtcgttgacttggtggttcaagtcgagaaaccgacgatcactgagcaggtc
aatgaagtcctgcaaaaagcttctcaaacgacgatgaagggcatcatcaagtactcggat
ctgcccttggtctcttccgacttccggggtactgacgagtcttcgatcgttgactccagc
ctgaccttggtaatggatggcgatctcgtcaaagtaattgcttggtacgacaacgagtgg
ggctacagccaacgagttgtcgacttggctgaactggccgctcgcaaatgggccgcttag

DBGET integrated database retrieval system