KEGG   Synechococcus elongatus PCC6301: syc2470_cHelp
Entry
syc2470_c         CDS       T00163                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:syc00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    syc2470_c (murE)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    syc2470_c (murE)
Enzymes [BR:syc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     syc2470_c (murE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(2632099..2633607)
Genome map
AA seq 502 aa AA seqDB search
MRRESMNLRSLLASTPTQVLQPQHAALDLAITGLQTDSRRCQPGDLFLGMPGTQVDGGQF
WPEAIAAGAVAVIVTPTALAQRPLSANPEACLILSDQMPVTAGAIAAAFYNQPAQTLKLI
GVTGTNGKTTTTHLVEHFLNAADTKTALLGTLYNRWPGYSEVAQHTTPFATDLQAQLATA
VDAGCQAAVMEVSSHALDQGRVNGCGFDVAVFTNLTQDHLDYHGTMEAYFAAKARLFAPP
YLRGKAVINADDAYGQRLITMTPPGQCLTYSVVGTADFCTTDLQYGPTGVEGTIKTPDGA
FPFRSPLVGQFNLANLLGAIAAGWTLGLPIETMLAVVPDFVGVPGRMERVVGQDSDPTVI
VDYAHTPDSLENLLKAARPFIQGELICVFGCGGDRDRTKRPLMGEIAARLADRVIITSDN
PRTEDPRQILADIVAGIPAASPVVVEADRAAAIRQAILSAQPGDGVLLAGKGHEDYQILG
TTKIHFDDREQARLALAERQSA
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgcggagggaatccatgaacctgcgatcgctgctcgcttcaaccccgacccaggtcctc
caaccgcaacatgccgccttagatttagccattaccggcctccaaactgactcccgtcgc
tgtcaacccggcgatctgtttctgggaatgccgggcacccaagtcgatggcggtcaattt
tggcccgaagcaatcgcggcgggggcagtggctgtgatcgtgacacctacggcgctagcc
caacggccactctcggccaacccagaggcctgcctaatcttgagcgatcaaatgccggtg
acggctggggcgatcgcggcagccttctacaaccaaccggcgcagaccctcaagttaatc
ggagtgaccggcacgaatggcaaaacgacaaccacccatctagttgagcattttctcaac
gctgccgacacgaaaaccgccctcctaggcacgctttataaccgctggcccggctattcc
gaagtggcgcaacatacaacgccttttgccacggatttgcaggctcaactggcgacggca
gtagacgcaggttgccaagctgctgtcatggaagttagttcccacgcactcgatcaaggt
cgggtcaacggttgcggctttgatgttgccgtcttcacgaacctgacccaagatcacttg
gattatcacgggacgatggaggcctactttgcggccaaagccagattgtttgcgccgccc
tatctgcgcggcaaagcagtgatcaacgccgacgatgcctacggtcagcgcttgattacg
atgacaccacccgggcaatgtctgacttacagcgttgtgggaacagcggacttttgcacg
actgatttgcagtacgggcctaccggagttgaaggcacgattaagacgccagatggtgct
tttcccttccgatcgcctctggtcggtcagttcaatctcgcgaacctgttaggggcgatc
gctgcgggttggaccttgggcctgccgatcgagacaatgctggccgtcgtccctgacttt
gttggcgtacccggtcggatggaacgggtcgtgggtcaagacagcgatccgacggtgatc
gtcgactatgcccacacgcccgacagtctcgaaaatctcctaaaagcggctcgtccattc
attcaaggtgagctgatctgtgtgtttggctgtggcggcgatcgcgatcgcaccaaacgt
cctctgatgggagaaattgcggcacgactggccgatcgcgtcattattacttccgacaac
ccgcgcaccgaagatccgcgccagattttggcggatattgtggcgggcattccggctgcc
agtccggtggtggttgaagccgatcgcgcagcagcgattcgtcaggcgattctctcagct
cagcccggtgatggggtgctcttggcgggcaaaggccacgaagactatcagattcttggc
acgaccaaaattcacttcgacgatcgcgagcaggcgcggttggccttggccgagcgtcag
tctgcatga

DBGET integrated database retrieval system