KEGG   Synechococcus sp. CC9605: Syncc9605_0030Help
Entry
Syncc9605_0030    CDS       T00292                                 

Definition
glyceraldehyde 3-phosphate dehydrogenase (NADP+) (EC:1.2.1.13)
Orthology
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
syd  Synechococcus sp. CC9605
Pathway
Glycolysis / Gluconeogenesis
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:syd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Syncc9605_0030
   01230 Biosynthesis of amino acids
    Syncc9605_0030
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Syncc9605_0030
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Syncc9605_0030
Enzymes [BR:syd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Syncc9605_0030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
29810..30835
Genome map
AA seq 341 aa AA seqDB search
MTLRVAINGFGRIGRNVLRGWISRGADTGLEIVGMNSTSDPATSAHLLTYDSILGRLDPS
VDIKTTDSSMFVNGKEIKFFADRNPLNCPWKEWGVDLVIESTGVFNTDEKASMHIQAGAK
KVILTAPGKGDRVGTFVVGVNDDQYRHEDWDILSNASCTTNCLAPIVKVLDQNFGLDWGL
MTTIHSYTGDQRILDNSHRDLRRARAAALNMVPTTTGAAKAVALVYPEVKGKLTGFAMRV
PTPNVSAVDLTFGPSRAASVDDIKAAIKSASENGMKGIIKYGDLPLVSTDYAGTNESTIF
DADLTYAMGDKAVKILAWYDNEWGYSQRVVDLAEVVAKNWK
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgcgcgttgcgatcaatggattcggccggatcggtcgcaatgttctgcgggga
tggatcagccgtggcgctgacaccggcctggaaatcgtggggatgaactccacctccgac
cccgccaccagcgctcacctgctgacctacgactccatccttggacgtcttgatccctcg
gtggacatcaagaccacggacagctcaatgttcgtcaacggtaaggagatcaagttcttc
gccgaccgcaatcccctcaactgcccctggaaggagtggggtgttgacctggtgatcgag
tccaccggtgtgttcaacaccgatgagaaggccagcatgcacatccaggctggcgccaag
aaggtgatcctcaccgcccctggcaagggtgatcgcgtcggcactttcgttgtgggcgtc
aacgacgaccagtaccgccacgaggactgggacatcctcagcaacgccagctgcaccacc
aactgcttggccccgatcgtcaaggttttggaccagaacttcggccttgactggggtctg
atgaccaccatccacagctacaccggcgaccagcggatcttggataacagccaccgcgac
ctgcgccgtgcccgtgctgcagctctgaacatggttcccaccaccaccggtgcagccaag
gccgtggctctggtttaccccgaggtgaagggcaagctcaccggcttcgccatgcgcgtt
cccaccccgaacgtctccgctgttgacctcaccttcggtccctctcgcgccgccagcgtt
gacgacatcaaggccgccataaagtcggcttccgagaacggcatgaaggggatcatcaag
tacggcgatctgcccctggtgtccaccgactacgccggcaccaacgagtccaccatcttt
gacgccgacctcacctacgccatgggtgacaaggctgtgaagatcctggcctggtacgac
aacgagtggggctacagccagcgtgttgttgacctcgccgaggtggtggccaagaactgg
aagtga

DBGET integrated database retrieval system