KEGG   Synechococcus sp. CC9605: Syncc9605_0091Help
Entry
Syncc9605_0091    CDS       T00292                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
syd  Synechococcus sp. CC9605
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:syd00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:syd00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(91712..92236)
Genome map
AA seq 174 aa AA seqDB search
MYGRYSRLTSALHPCFTMAISVSAVSVTTPDGSSKSLGDYAGKVLLIVNVASRCGFTKQY
AGLQALNEAYAAKGLAVLGFPCNDFGAQEPGSLDEIKSFCSTTYGADFELFEKVHAKGST
TEPYTTLNQMEPSGDVEWNFEKFLVGKNGTVIARFKSGVTPEDLKSAIEAALAA
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
gtgtatggccgttacagccggttaacctctgcgctccatccttgtttcaccatggcgatc
agcgtcagtgccgtctccgtcaccacccctgacggcagcagcaaatccctgggcgattac
gccggcaaggtgctgctgatcgtgaacgtggccagccgctgtggcttcaccaagcagtac
gcgggtctgcaggccctcaatgaggcctatgccgccaagggcctggcggtgctgggcttc
ccctgcaacgacttcggcgcccaggagcccggcagcctggacgaaatcaagagcttctgc
tccaccacctacggcgctgacttcgaactgttcgagaaggtgcacgccaaaggcagcacc
acggagccctacaccaccctcaatcagatggaaccctccggtgatgtggagtggaacttc
gagaagttcctggtgggcaaaaacggcaccgtgatcgctcgcttcaagagcggcgtcacc
cctgaagacctcaagtcggcgattgaggcggctctggcggcttga

DBGET integrated database retrieval system