KEGG   Synechococcus sp. CC9605: Syncc9605_0127Help
Entry
Syncc9605_0127    CDS       T00292                                 

Definition
photosystem I subunit VII
Orthology
K02691  
photosystem I subunit VII
Organism
syd  Synechococcus sp. CC9605
Pathway
Photosynthesis
Metabolic pathways
Module
Photosystem I
Oxygenic photosynthesis in plants and cyanobacteria
Class
Metabolism; Energy metabolism; Photosynthesis [PATH:syd00195]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
124486..124761
Genome map
AA seq 91 aa AA seqDB search
MPQAFVCIGHMSHAVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKAGQIASSPRTEDCVG
CKRCETACPTDFLSIRVYLGDETTRSMGLAY
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
ttgccgcaagccttcgtatgcatcgggcacatgtcccacgccgtcaagatctacgacacc
tgcatcggctgcactcagtgtgtgcgtgcctgccctctcgacgtgcttgagatggttccc
tgggacggctgcaaggccggccagattgcttcttctcctcgcacagaagattgcgttggt
tgcaagcgctgcgaaaccgcctgccccaccgacttcctcagcatccgcgtatatctcgga
gacgagacaacgcgctccatgggtctggcctactga

DBGET integrated database retrieval system