KEGG   Synechococcus sp. CC9605: Syncc9605_0127Help
Entry
Syncc9605_0127    CDS       T00292                                 

Definition
(GenBank) photosystem I iron-sulfur center subunit VII (PsaC)
  KO
K02691  photosystem I subunit VII
Organism
syd  Synechococcus sp. CC9605
Pathway
syd00195  Photosynthesis
syd01100  Metabolic pathways
Module
syd_M00163  Photosystem I
syd_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:syd00001]
 Metabolism
  Energy metabolism
   00195 Photosynthesis
    Syncc9605_0127
Photosynthesis proteins [BR:syd00194]
 Photosystem and electron transport system
  Photosystem I (P700 chlorophyll a) [OT]
   Main subunits
    Syncc9605_0127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_6 Fer4_9 Fer4_7 Fer4_4 Fer4_10 Fer4_17 Fer4_2 Fer4_16 Fer4_3 Fer4_22 Fer4_13 Fer4_8 Fer4_15 Fer4_18 ETF_QO
Motif
Other DBs
NCBI-ProteinID: ABB33903
JGI: Syn_cc96050127
CyanoBase: Syncc9605_0127
CYORF: Syncc9605_0127
UniProt: Q3ANC9
Position
124486..124761
Genome map
AA seq 91 aa AA seqDB search
MPQAFVCIGHMSHAVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKAGQIASSPRTEDCVG
CKRCETACPTDFLSIRVYLGDETTRSMGLAY
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
ttgccgcaagccttcgtatgcatcgggcacatgtcccacgccgtcaagatctacgacacc
tgcatcggctgcactcagtgtgtgcgtgcctgccctctcgacgtgcttgagatggttccc
tgggacggctgcaaggccggccagattgcttcttctcctcgcacagaagattgcgttggt
tgcaagcgctgcgaaaccgcctgccccaccgacttcctcagcatccgcgtatatctcgga
gacgagacaacgcgctccatgggtctggcctactga

DBGET integrated database retrieval system