KEGG   Synechococcus sp. CC9605: Syncc9605_0127Help
Entry
Syncc9605_0127    CDS       T00292                                 

Definition
photosystem I subunit VII
Orthology
K02691  
photosystem I subunit VII
Organism
syd  Synechococcus sp. CC9605
Pathway
Photosynthesis
Metabolic pathways
Module
Photosystem I
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:syd00001]
 Metabolism
  Energy metabolism
   00195 Photosynthesis
    Syncc9605_0127
Photosynthesis proteins [BR:syd00194]
 Photosystem and electron transport system
  Photosystem I (P700 chlorophyll a) [OT]
   Main subunits
    Syncc9605_0127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
124486..124761
Genome map
AA seq 91 aa AA seqDB search
MPQAFVCIGHMSHAVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKAGQIASSPRTEDCVG
CKRCETACPTDFLSIRVYLGDETTRSMGLAY
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
ttgccgcaagccttcgtatgcatcgggcacatgtcccacgccgtcaagatctacgacacc
tgcatcggctgcactcagtgtgtgcgtgcctgccctctcgacgtgcttgagatggttccc
tgggacggctgcaaggccggccagattgcttcttctcctcgcacagaagattgcgttggt
tgcaagcgctgcgaaaccgcctgccccaccgacttcctcagcatccgcgtatatctcgga
gacgagacaacgcgctccatgggtctggcctactga

  All links  
No link information was found.   
DBGET integrated database retrieval system