KEGG   Synechococcus sp. CC9605: Syncc9605_0149Help
Entry
Syncc9605_0149    CDS       T00292                                 

Definition
RNAse III (EC:3.1.26.3)
Orthology
K03685  
ribonuclease III [EC:3.1.26.3]
Organism
syd  Synechococcus sp. CC9605
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(151016..151741)
Genome map
AA seq 241 aa AA seqDB search
MDPSRAAELTDLIQRLDAEIPIEPELLILVDQAMTHVSSGRDRNLERLEFLGDAVLRLAA
TEFIDRHHADLTVGACSNLRAQLVSDRWLADVGEALGIEEHLLLGRHAQGDRSARSRLRA
DATEALIGALYTALGNLKAIHRWLTPHWSATTQAVLATPHQFGGKTTLQEWSQGQGLGLP
RYATEECSRQHGDPERFRCQVSIQGRNLAEAKGRSRKEAEQNAATAALQALEGSDAPQKS
Q
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
gtggatccatcccgcgccgcagaactcaccgacctgatccagcgcctcgatgctgagatc
ccgatcgaaccggagctcctgattctggtggatcaggcaatgacccacgtctcgagcggc
cgagaccggaacctggaacggctcgagttccttggtgatgcggtgctgcggcttgccgcc
accgaattcattgatcgccaccacgccgatctcacggtgggtgcctgctccaaccttaga
gcccagctggtaagcgaccgctggctggctgacgtgggtgaagctcttggcatcgaggag
cacctgctgctggggcggcacgcccagggggatcgttccgcacgatccaggctgcgggcc
gatgccaccgaagctctgatcggtgcgttgtacaccgccctaggcaacctcaaggcgatt
caccgctggctgaccccccactggtctgccaccacccaagcggtgctggcgactccccat
cagttcggcggtaaaacaacactgcaggagtggagccagggccagggcctcggcctgccc
cgctacgccaccgaggaatgcagccgccagcacggcgaccccgaacgcttccgctgccag
gtgagcatccaaggcaggaatctggcggaagccaaaggcagatcccgcaaggaggccgag
cagaacgcggcaacagccgcccttcaggccctggaaggcagcgacgcgccgcagaaatcg
cagtga

DBGET integrated database retrieval system