KEGG   Synechococcus sp. CC9605: Syncc9605_0197Help
Entry
Syncc9605_0197    CDS       T00292                                 

Definition
(GenBank) putative photosystem II reaction center J protein
  KO
K02711  
photosystem II PsbJ protein
Organism
syd  Synechococcus sp. CC9605
Pathway
Photosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syd00001]
 Metabolism
  Energy metabolism
   00195 Photosynthesis
    Syncc9605_0197
Photosynthesis proteins [BR:syd00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Other common subunits
    Syncc9605_0197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(208764..208964)
Genome map
AA seq 66 aa AA seqDB search
MSGKKSPYPDGRIPDRNPDGTPAVPWRSRWTEGVLPLWLVATAGGMAVLFVVGLFFYGSY
TGVGSA
NT seq 201 nt NT seq  +upstreamnt  +downstreamnt
atgagcggaaaaaaatccccgtatcccgacggtcgaattcccgatcgcaaccctgatggc
acacctgctgtgccctggagaagccgctggacagaaggtgttcttcctctatggctggtt
gccactgcgggaggcatggccgttctttttgttgtgggactgttcttctacggctcctac
actggcgttggctccgcttaa

DBGET integrated database retrieval system