KEGG   Synechococcus sp. CC9605: Syncc9605_0492Help
Entry
Syncc9605_0492    CDS       T00292                                 

Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23 4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
syd  Synechococcus sp. CC9605
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:syd00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Syncc9605_0492
Enzymes [BR:syd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     Syncc9605_0492
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Syncc9605_0492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(481680..482516)
Genome map
AA seq 278 aa AA seqDB search
MPELPEVETVRRGLADRLVDFKIAQVEVCRPRAIASPGGPDEFVAGLCGTTVGQWHRRGK
YLMTALEPESGVWGVHLRMTGQFQWHEQPSEPCKHTRVRLWNSKEEELRFVDVRSFGEMW
WVPPGQAIEEVITGLTRLGPEPFSADFSASYLKQKLKGSSRPIKTALLDQALVAGAGNIY
ADESLFASGIAPFTPAGQLNLQQLERLRDALVNVLTISIGAGGTTFSDFRDLEGVNGNYG
GQAWVYRRGGEPCRNCGTTIQREKLSGRSTHWCPTCQS
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
ttgcctgaactccctgaagtcgagacggtccgccggggacttgcagaccgtcttgtcgat
ttcaaaattgcgcaggttgaagtctgccgaccaagggcgattgccagccctggaggtccc
gacgagtttgttgctggcctctgcggcacaacggtggggcagtggcatcgcagagggaaa
tatctgatgacagccctggagcccgagagcggtgtttggggtgttcatctgcgcatgacc
ggccaattccaatggcatgagcagccctcagaaccgtgcaaacacacccgtgttcgcctc
tggaactccaaagaggaggagttgcgctttgtggatgtgcgcagcttcggagaaatgtgg
tgggtgcctccgggtcaggcgattgaagaggtgatcacaggcttaacgcgactcggccct
gaacccttcagcgccgacttctccgccagttatctgaagcagaaactcaagggcagcagc
cgaccgatcaaaacagcgctcttggaccaagccctggtggccggggcgggcaacatctac
gcggatgaatcccttttcgcatcaggcatcgcccccttcacgccagcagggcagctgaat
ctccaacaactggagaggttgcgagatgccctggtcaatgtgctgaccatcagcattgga
gccggtggcactaccttcagtgatttccgcgatctcgagggggtgaatggcaactacggc
ggccaggcctgggtctaccggcgtggaggggaaccctgccgcaactgcggaacgaccatt
caaagagagaaactgtccggccgaagcacccactggtgcccgacctgtcagagctga

DBGET integrated database retrieval system