KEGG   Synechococcus sp. CC9605: Syncc9605_0500Help
Entry
Syncc9605_0500    CDS       T00292                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
syd  Synechococcus sp. CC9605
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:syd00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(491134..492639)
Genome map
AA seq 501 aa AA seqDB search
MAEQPLLLALDQGTSSSRAALFSSSGDLVISASAPLPISYPADGWVEQDPMAIWTSQRQA
LVQLDSKLSEPQRKAVVSCGITNQRETTLLWRRSNGLPCGPALVWQDGRTAAICEAWKQQ
GLEQEWCRRTGLLLDPYFSASKIRWMLDHYQDAQAAAASDDLCFGTVESWLLWQLTGGQR
HGSDMSNASRTLLMDLEQQRWVDDFRESTGLPANALPELLPCRGEFGHITTDLPFAGLPI
QAMLGDQQAATLGQLCLQPGEGKCTYGTGAFLVINTGDVIRRSDAGLLSTLGWTDAAGTP
SFCLEGSLFNAGTVIQWLRDGLQIIDQAPQVNELARSVPDSGGVMLVPAFTGWGTPHWDP
QARGVLVGLTRDSGRGHIARAALEGIALSVATLVELAEQALGTGLGELAVDGGAAASDPL
LQAQADCTGLTVRRPASLESTARGVALFAGLQAGVISDLEQLAIARRDGAELFHPQMGAS
ERHRWRSRWQDAVSRSLGWHG
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggcggagcagcctcttcttctggccctcgatcagggcaccagcagctccagagccgcg
ctgttcagcagctccggagatctggtgatcagcgccagtgcgccgctgccgatttcctac
cccgccgatggatgggtggaacaggacccgatggcgatctggaccagccagcggcaggcc
ctggtgcagctcgattcgaagctcagcgaaccacagcgcaaggcagtggtgagctgcggc
atcaccaaccaacgggaaaccaccctgctctggcgccgcagcaatggcctcccctgtggc
ccggccctcgtctggcaggacggccgcaccgccgccatctgcgaggcctggaagcagcag
ggactggagcaggagtggtgccggcgcaccggtttgctgctcgacccctacttcagtgcc
agcaagatccgctggatgctcgatcactaccaggacgcccaggctgccgcagccagcgat
gacctctgtttcggaacagtggagagctggctgctctggcaactcaccggcgggcagcgc
cacggcagtgacatgagcaatgccagccgaacattgctgatggacctggagcagcagcgc
tgggtggatgacttccgagagtccacagggctccccgccaacgctctgcccgaactgctt
ccctgccgcggggagttcgggcacatcactacggatcttcccttcgcaggcctaccgatc
caggcgatgctcggcgaccaacaggccgccaccctgggccagctctgtctgcagcccgga
gaaggcaagtgcacctacggcacgggagcctttctggtgatcaacaccggtgacgtcatc
cgccgctcggatgcggggctgctcagcaccctcggctggaccgatgccgccggaacaccc
agcttctgcctggagggaagtctgttcaacgccggcaccgtgatccagtggctgcgggat
gggctgcagatcattgatcaggcccctcaggtgaacgaactggcgcgttcagtgccggat
tcgggaggggtgatgctcgtgcccgccttcaccggctggggaacacctcactgggatccc
caggcacgcggcgttctggtgggcctcacccgcgacagcggacgcggtcacatcgcccga
gcagcgctggagggaatcgccctgtcggtagcgactttggtggaacttgccgagcaggcc
cttggcacgggcctgggtgaactggcggtggatggtggcgccgcggcctcggatcctctc
ctgcaggcacaggccgattgcaccggtctgacggtgcggcgtcccgccagcctcgagagc
accgcccggggggtggcgctgttcgcaggccttcaggctggggtgatcagcgacctggag
cagctcgcaatcgcacggagggacggcgcggaactgttccacccacagatgggtgcatcc
gagcgccaccggtggcgctcacgctggcaggacgccgtctccagaagcctggggtggcat
ggctga

DBGET integrated database retrieval system