KEGG   Synechococcus sp. CC9605: Syncc9605_0507Help
Entry
Syncc9605_0507    CDS       T00292                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
syd  Synechococcus sp. CC9605
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:syd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Syncc9605_0507
Enzymes [BR:syd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Syncc9605_0507
Exosome [BR:syd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Syncc9605_0507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
498745..499746
Genome map
AA seq 333 aa AA seqDB search
MELTYRPRRLRRTPALRAMVREHSLSAADFIYPLFVHEGAEVEPIGAMPGASRWSLAALT
GEVQRAYDLGVRCIVLFPKVSEGLKTEDGAECFNANGLIPRAIRQIKEAIPEMAIMTDVA
LDPYSCDGHDGIVSQDGVVLNDETIELLCKQAVVQAEAGADLIGPSDMMDGRVGAIREAL
DDEGFEHVGIISYTAKYSSAYYGPFRDALDSAPRAAGSKPIPKNKDTYQMDPANAREAIT
EAQLDEQEGADIMMVKPGLAYLDIIHLLREESELPIAAYNVSGEYSMVKAAAERGWIDEK
AVVLETLLSFKRAGADLILTYHACDAAAWLKEA
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggagctcacctaccgcccccgtcgtctgcggcgtacgcccgccctacgcgccatggtg
cgtgagcacagcctctcggctgcagacttcatctaccccctgtttgtgcatgaaggcgct
gaggtggagccgattggtgccatgcctggtgccagccgttggagcctggcggccctcacc
ggcgaagtgcagcgtgcctacgacctgggagtgcgttgcatcgttctgttccccaaggtg
tcggaggggctgaagaccgaagacggggccgaatgcttcaacgccaatggcctgatcccg
cgagcgattcgccagatcaaggaagccatccccgagatggcgatcatgactgatgtcgcc
ctggatccctattcctgcgatggtcatgacgggatcgtcagccaggacggcgtagtcctc
aacgacgagacgattgaactgctttgcaagcaggctgttgtgcaggccgaagcaggcgct
gatctgatcggccccagcgacatgatggacggccgggtcggtgccatccgcgaagccctc
gacgacgaaggctttgaacatgtgggcatcatcagctacacggcgaagtactcctccgcg
tactacggacctttccgtgatgctctcgactctgccccgcgtgccgccggtagcaagccg
atccccaaaaacaaggacacctatcagatggatcccgccaatgctcgggaagccatcacc
gaagcccagctcgatgagcaggagggcgcagacattatgatggtgaaacccggtctggcc
tatctcgatatcattcaccttctgcgtgaggagtcggaactccccatcgctgcttacaac
gtgagtggtgaatattcgatggttaaggccgcggctgagcggggctggatcgatgaaaag
gccgtagtgcttgagacgttgctgagcttcaagcgcgccggtgctgatctgatcctcacg
taccacgcctgcgatgcagcggcttggttgaaggaggcctga

DBGET integrated database retrieval system