KEGG   Synechococcus sp. CC9605: Syncc9605_0569Help
Entry
Syncc9605_0569    CDS       T00292                                 

Definition
CysQ protein-like
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
syd  Synechococcus sp. CC9605
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:syd00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Syncc9605_0569
Enzymes [BR:syd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Syncc9605_0569
Transfer RNA biogenesis [BR:syd03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Syncc9605_0569
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
553494..554411
Genome map
AA seq 305 aa AA seqDB search
MMPSSAVLPAGVNKEALLTELRRLSWVAADILRAYARGEQPPHGFPKALSVDEGGEGPVS
AADLAVNKWLLDGLSAAFPKANWTLLSEETAKEQLTEGQPLSAEWLWILDPLDGTKDFLQ
GTGEYAVHLALVRDKRPVIGVVLLPEADELWIGIVGEGAWCEDRQGERSPVRFSDRTEVS
DLILVASRSHRDDRLVKLIDALDLGGSKAVGSVGFKVATILRGETDLYVSLSGKSAPKDW
DMAAPEAVLLAAGGRFTHADQADLTYNTGDVRQAGCLIASHGKAHAELGERATRAMAEID
PGFQV
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgatgcccagctctgccgtcctccccgctggcgtgaacaaggaggctctgctgactgaa
ctgcgtcgcctcagttgggtagccgccgacatcctgcgggcctatgcccgcggcgagcag
cccccgcatggtttccccaaggccttgagtgttgatgaaggcggagagggcccggtgtct
gcggctgatctggctgtgaacaagtggttgctggatggtctgtccgccgcgttccccaag
gccaactggactctgctgagcgaggagaccgccaaggagcagctcacggaaggtcaaccg
ctgtcggcggagtggctgtggattctcgatcccctggatggcaccaaggattttctgcag
ggcacaggcgaatacgccgttcatctggccctcgtgcgcgacaagcggccggtgatcggt
gttgtgctcctgccggaagccgatgaactttggatcggcatcgttggcgagggtgcctgg
tgtgaagaccgtcagggtgagcggtcgccggttcgcttcagcgacagaactgaggtttca
gacctgatcctggtggccagccgtagccaccgcgacgaccgtttggtcaagctcattgat
gcccttgacctcggcggttccaaagccgtcggcagcgttggcttcaaggtggccacgatc
ctgaggggcgaaaccgacctttacgtctccctctccggcaagagcgctcccaaggattgg
gacatggctgctccggaggcggtgctgctcgcggccggtggtcgtttcacccatgcggat
caggccgacctcacctacaacaccggcgatgtacgtcaggccggctgtctgatcgccagc
cacggaaaagcccacgccgagctcggagagcgtgcgacgcgggccatggccgagatagat
cccggctttcaggtctga

DBGET integrated database retrieval system