KEGG   Synechococcus sp. CC9605: Syncc9605_0632Help
Entry
Syncc9605_0632    CDS       T00292                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
syd  Synechococcus sp. CC9605
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:syd00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Syncc9605_0632 (gmk)
Enzymes [BR:syd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Syncc9605_0632 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
611035..611592
Genome map
AA seq 185 aa AA seqDB search
MSTSGKLTLITGPSGVGKGTLVNQLLERHPQIWLSVSATTRSPRQGEQDGINYFFHSRAG
FEALVEQGGFLEWAEFAGNCYGTPRGPVEQQMAAGRPVLLEIELEGARQVRRSFPDGFQI
FLAPPSFDELERRIRGRGTDSEDAIQRRLTRAREELEAQQEFDAVVINDDLESALNQVET
LMGLG
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccagtggaaagctcaccttgatcaccggccccagtggcgtcggcaagggaacc
ctggtgaaccagctgctggaacggcatccccagatctggctgtcggtgtcggccaccacc
cgttcgccgcgccagggggagcaggacggcatcaactacttcttccacagccgtgcgggg
tttgaggccttggtggagcagggaggttttcttgagtgggcggaatttgcggggaattgc
tacggcaccccccgaggtcccgttgagcaacagatggcggcggggcgccccgtgctgctg
gagattgagcttgaaggtgcccgtcaggtgcgtcgcagttttccggacggttttcagatt
tttctggctccccccagctttgatgagttggagcgccggattcgggggcgcggaaccgat
tcagaggacgccattcagcgccgcctgactcgcgctcgcgaagaactcgaggcccaacag
gaattcgacgctgtcgtgatcaatgacgatctcgaatcagcgttgaaccaggtggagacc
ctgatggggctgggatga

DBGET integrated database retrieval system