KEGG   Synechococcus sp. CC9605: Syncc9605_0732Help
Entry
Syncc9605_0732    CDS       T00292                                 

Definition
GTP cyclohydrolase (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
syd  Synechococcus sp. CC9605
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Syncc9605_0732
Enzymes [BR:syd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Syncc9605_0732
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
699774..700523
Genome map
AA seq 249 aa AA seqDB search
MTSTVPFVSNGVANGNGNGSLNPQISARIRERLREAGASFLANDNIADHLQPGELDQLQV
EVADKVRDLLRSLVIDIDNDHNTHETAERVAKMYLQEVFKGRYHQQPKVASFPNVKQLDE
IYTVGPITVRSACSHHLVPIMGNCWIGIKPGARVIGLSKFTRVADWVFSRPHIQEEAVMI
LADEIEKLCEPQGLGIIIKAQHYCMKWRGVKEPQTSMVNSVVRGDFRHDPSLKQEFFELV
RQQEALLST
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgacctccacagtccctttcgtttccaacggcgtcgccaacggcaacggcaatggcagc
ttgaatccccagatctcagcgcgcatccgtgaacgcttgagagaggccggtgcctccttc
ctggccaacgacaacatcgctgatcacctccagcccggtgagctcgatcaacttcaggtt
gaagttgcagacaaggttcgcgacctgctgcgcagcctggtgatcgacatcgataacgac
cacaacacccacgagacggcggagcgcgtcgccaagatgtacctccaggaggtgttcaag
gggcgttaccaccagcagcccaaggtggccagcttccccaatgtgaaacagctggatgag
atctacaccgttggcccgatcacggtgcgctcggcctgttcacatcacctggtgccgatc
atgggcaactgctggattgggatcaagccgggtgcccgggtgatcggcctctccaagttc
acccgcgttgccgactgggtgttctcccgccctcacatccaggaagaggctgtgatgatc
cttgccgacgaaatcgagaagctctgtgagccccagggtctcggcatcatcatcaaggcg
cagcactactgcatgaagtggcgtggcgtgaaggagccccaaaccagcatggtgaattcc
gtggtgcgcggcgatttccgccacgaccccagcctcaagcaggagttctttgagctggtg
cgtcagcaggaagcacttctgagcacatga

DBGET integrated database retrieval system