KEGG   Synechococcus sp. CC9605: Syncc9605_0790Help
Entry
Syncc9605_0790    CDS       T00292                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
syd  Synechococcus sp. CC9605
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:syd00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:syd00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
753755..755260
Genome map
AA seq 501 aa AA seqDB search
MTQALHALLSDAGIAVPPGLVNPGLGAITTDSRRVGPGTLFLGLPGERVDGGTFWAQALE
AGAAAAVIGAEAAAAQPPGADAPVVVIQEPVARRIGEIAAAFWDHPCRCMALIGVTGTNG
KTTTTHLIEHLAASAGQSVGLFGTLVNRWPGQSITATHTTAFADLLQGQLAEAASAGCGL
AAMEVSSHALAQQRVAGCRFAGAVFTNLTQDHLDYHASMEDYFEAKASLFADPLLLADGA
RSVVNSDDPWGERLAERLGAACWRSSLEDPSAELHMSDLQMTAAGVEGRLISPVGEGRFR
SPLLGRFNLMNLLQAIGVLLQQQLPLPVLLEAIGRFGGVPGRMERVILNGVDAANLPPVL
VDYAHTPDGLDNALSAARPFCAGRLICVFGCGGDRDRGKRPQMAEIAARLADRVVVTSDN
PRTEDPRQILDDVVAGIPPGSDLLVEGDRAQAIASAIAEAEPNDLVLVAGKGHEDYQILG
TEKVHFDDREEAERALRLRLS
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaggcgttgcatgccctgttgagtgatgcaggcatcgcagtgccgccggggctg
gtgaaccctgggttgggggcgatcaccaccgattcccgccgcgtcggccctggaactctg
tttctcggtctccccggcgaacgggtggatggaggcaccttctgggcccaagcccttgag
gccggtgctgccgctgctgtgattggagctgaagctgctgcagcacaaccgcctggcgcg
gatgcccctgtggtggtgatccaggagccggtggcgcgtcgaatcggtgagattgccgcg
gcgttttgggatcacccctgcaggtgcatggccctgattggtgtgaccggcaccaatggc
aaaaccaccaccacccatttgatcgagcatctggccgcttcggccggccaatccgtgggc
cttttcggcacgttggtgaaccgctggcccggccaaagcatcacggctacccacaccacg
gcctttgccgacctcctgcaggggcaactcgccgaggctgcctccgccggttgcggcctg
gcggccatggaggtgagttcccacgccctggcgcagcagcgcgtggcgggctgccgcttc
gcaggagccgtgttcaccaacctcacccaggaccacctcgattaccacgcctccatggag
gactacttcgaggccaaggcgtcgctgtttgcggatcctctgctgcttgccgatggcgcg
cgatcggtggtcaacagcgatgacccctggggggaacgcctggccgaacggctcggtgcc
gcctgttggcgcagctcgctggaggatccatcggctgagttgcacatgagcgacctgcag
atgacggctgctggggtggagggccgcttgatcagtcctgtgggtgagggccgtttccgt
tcgcccttgctggggcgcttcaacctgatgaacctgttgcaggcgataggggtgctgctt
cagcagcagttgcccttgccggtgctgctggaggccatcggccgtttcggtggcgtgccc
ggacggatggagcgggtgattttgaacggggtggatgcagcgaatttgcccccggtgctg
gtggattacgcccacactcccgatggtctggacaatgctctttctgcagcgcgtccgttc
tgcgcgggccggctgatctgtgtgttcggttgcggtggtgatcgggaccggggcaagcgt
ccgcagatggcggaaattgcggcacgcctggctgaccgtgtggtggtcacctccgacaac
ccccgcaccgaggatcctcggcagatcctggatgacgttgttgccgggattccgcccggt
agcgatctgctggtggagggtgatcgagcccaggcgattgcttcagccattgccgaagct
gagccgaacgatctggtgctggtggccggcaaggggcacgaggattaccagattctcggc
accgaaaaagtgcacttcgacgatcgcgaggaagcggaacgcgctttgcgcttgaggttg
tcttga

DBGET integrated database retrieval system