KEGG   Synechococcus sp. CC9605: Syncc9605_0826Help
Entry
Syncc9605_0826    CDS       T00292                                 

Definition
cholesterol oxidase (EC:1.1.3.6)
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
syd  Synechococcus sp. CC9605
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
795607..797115
Genome map
AA seq 502 aa AA seqDB search
MEHSPAIVIGSGFGGSVAALRLAEAGIKTLVIERGKRWTIQDPTVNETFSTFDSLDGRAE
WLNDTGRSETPAYEGLPITKHTGIMECVKHGKYTFLVGAAVGGGSHCYGGILIEPPEELW
NNQIPMIDYSEMRDTYFPVVHKTIGSSPIPDDILNSEYYLGLRSLVSQAEKAGFTECSST
NNGMKDGYVRFKMGIDWDATREEIANKRVASQIKAEFWFGQNSGAKQTLDTNYLKLAEET
GSVEIRPLHLVNSISENEDGLYIIETSRINTKGDVIETKLFSCNQLFLAAGVLGTCELLL
RAQSNNTISNLPSELGSNLGNDGDTFAIRTELDEKTNPHLGGPGAIAILNYENPIRPAIM
MRAPLTKFDRLFPDHNAIGTFIFSNSHHRGRLTFNKDTNGLDIEYELDYDAISASQALLD
RFQQANGGEIIPPDVQITGHQLGGAAMGSVCDSFGRVQGQKGLYVVDGSLIPGSSTCMNP
ALTIAAVAERALQNIIQEDILV
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggaacactcacctgctatcgtcatcggaagtggattcggtgggtctgttgctgccctg
cggcttgctgaggctggcatcaaaacgcttgttattgagcgaggtaaacgttggaccatc
caggatccaacagtcaacgaaaccttcagtacttttgacagtcttgatggtcgtgctgag
tggttgaatgatactggacgctcagaaactcctgcttatgaaggattacctataaccaag
cacacaggaattatggaatgtgtgaagcatggtaagtatacttttttggtgggtgctgct
gtcggcggtggatctcattgttatggagggattctgattgaacctcccgaggagctctgg
aataatcaaataccaatgattgattattctgaaatgcgagatacgtactttccagttgtt
cataagacaatcggctcttcaccgattcctgatgatattctaaattctgaatattattta
ggattaaggtcgcttgtttctcaggcagaaaaggctggttttacggaatgcagtagtacc
aacaatggaatgaaagatggttatgttagatttaagatgggaattgattgggatgccaca
agggaagaaattgctaataaacgtgtggcttcacagattaaagctgagttctggtttggc
caaaatagcggtgctaagcaaactttagacactaactatctaaaacttgccgaagaaact
ggatcagtcgagatcagacctcttcatcttgtcaattcgatttcagagaacgaagatgga
ttatacatcatagaaacatcgcgaatcaacaccaagggcgatgtgattgagacgaagctt
tttagttgcaaccaattgtttttggcggctggtgttcttggcacctgtgagctcctcttg
agagcacaatccaacaacacaatttccaatctaccctctgagcttggttccaaccttggc
aacgacggagatacttttgcaatacgtactgaacttgatgaaaaaaccaatccccatctt
ggcggacctggtgctattgccattttgaactatgagaatcccataagacccgccatcatg
atgcgcgcaccacttaccaagtttgatcgcttgtttcccgatcataatgctattgggact
tttatcttttcaaactctcatcaccgcggtcgcctaacttttaataaagataccaatggt
cttgatatcgaatatgagcttgattatgatgctatttcagcatcacaagcgttgctcgat
cgcttccaacaggctaatggtggggagattattcctcctgatgttcaaattactggtcat
caacttggaggagctgcaatgggtagtgtctgtgattcttttggacgtgtccagggtcag
aagggcttgtatgtcgttgatggatctctaattccaggttccagtacctgtatgaatcca
gctcttacgattgctgcagtggccgaacgtgctctgcagaacattatccaggaggacatt
ttggtttaa

DBGET integrated database retrieval system