KEGG   Synechococcus sp. CC9605: Syncc9605_0870Help
Entry
Syncc9605_0870    CDS       T00292                                 

Gene name
trpC
Definition
indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
syd  Synechococcus sp. CC9605
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:syd01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:syd00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
841386..842273
Genome map
AA seq 295 aa AA seqDB search
MEIRRRPPNPKVRVAHLEYAVPHDDEEPRHILEKIVWEKDREIDAARDKVPLDNLKQQIA
KLPPTKDFLGALQAAATKPAVIAEVKKASPSKGVIREDFDPVAIAKAYASGGASCLSVLT
DKTFFQGGFDVLVEVRQAVDLPLLCKEFVLSPYQLFQARAAGADAVLLIAAILSDQDLRY
LNKAAAALGLTVLVEVHDATEMDRVLSIGGFPLIGINNRDLTSFETDLATTERLLVDFND
RLKQQGVLLVSESGLFSRADLDRVQAAGAGAVLVGEALMRQQDVEAGLVQLIQAG
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggagatccgccgtcgtccccccaaccccaaagtgcgggtggcccatctcgaatatgcg
gtgccccacgacgacgaggaaccgcgtcacattctcgagaaaattgtctgggaaaaagac
cgtgagatcgatgccgcccgcgacaaggttcctctcgacaacctgaagcagcagattgcc
aagcttcctcccaccaaggatttcctgggggcgcttcaggcggccgccacgaaacctgcg
gtgatcgctgaggtgaaaaaagcgagccccagcaaaggggtgatccgtgaggatttcgac
ccggtggcgattgccaaggcctatgcctctggtggtgcaagctgcctctcggtgctcacc
gacaagaccttcttccagggcggctttgatgtcttggtggaggtgcgtcaggccgttgac
ctgcctctgctctgcaaggagtttgtgctgagcccctaccagctgttccaggccagagcg
gccggggctgatgcggtgctgctgatcgctgccatcctgtcggatcaggatcttcgttat
ctcaacaaggctgcggcggctttgggcctcaccgtgttggtggaggttcacgacgccacc
gaaatggaccgggtgctgagcattggcggcttccccttgattggaattaacaaccgtgat
ctgaccagcttcgagacggatctggccacgaccgagcggctgctggtcgacttcaacgac
cggttgaagcaacagggggtgttgctggtgagtgaatcaggtctgttcagccgggccgat
ctcgatcgcgtgcaagccgccggtgcgggggctgtgctggtgggggaagccctgatgcgg
cagcaggatgttgaagctggtctggtgcagttgatccaggccggttaa

DBGET integrated database retrieval system