KEGG   Synechococcus sp. CC9605: Syncc9605_0920Help
Entry
Syncc9605_0920    CDS       T00292                                 

Definition
hypothetical protein
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
syd  Synechococcus sp. CC9605
Pathway
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syd00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Syncc9605_0920
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Syncc9605_0920
Enzymes [BR:syd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Syncc9605_0920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
885709..888207
Genome map
AA seq 832 aa AA seqDB search
MASFGWYALNSLLGRGKQAKRWQPPEASWSRPFGLGWDKPYTVRYASNLDDGPNHGMPLG
GFGAGCFGRAPDGNINLWHLDGGEHWFGVLPDCQFALFEGNGRGKRAHALAVQPEQDASR
PEAGQPLKVWEWYPASTPDRSTGTYAARYPLSWTSYEGVYDAEVRCEAFSPILPGDYQRT
SYPVVVFVWTLRNPTDQPLDLSLLLSWRNTTGWFTNTDASAEVHFRDDGSPEHNYAPAIG
STAGQRNCCIDDGSLKGVLLEGNVSDPVAEGEGQWCIATAEQPGVTIQRCSRWNPSGDGR
ELWDSFSADGSIPESNNDRRSGSDDPLSAALAVQCQLAPGQSIEIPLVISWDLPVTAFAT
GSQALRRYTDFFAADANQAVAIAAEALRDWRRWRQQIEAWQQPVLQRQDLPKPLRMALFN
ELYDLCSGGSLWSAASPEDPYGRFGVLECLDYAWYESLDVRLYGSLALLQLWPELDKAVL
RSFARAIPAADATQRPIGWYFTQGKGRVEADRKVKGATPHDLGAPNEIPWDATNYTAYQD
CNLWKDLGSDFVLQVWRTFKLAPSGEDIRFLADCWPAAVEALRYLKTFDVNNDGLPDNGG
APDQTFDDWPLKGVSAYCGALWIAALEAALAIAQTLQLSTGLDTSAEQREFSGWLEQSRG
NFDKLLWNGEYYDIDAESGTPVVMADQLCGDFYARLLALPPVVSDANSLSTLKAVKEACF
EAFDGGSLGVANGLRRDGTPLDPNATHPLEVWTGINFGIASYYRLMGDKQTAQSICSAVV
EQVYSSGLQFRTPEAITAVNTYRACHYLRAMAIWGLWATETDWMLIPGADAR
NT seq 2499 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgttcggttggtacgctctgaactccctgctgggtcgcggcaagcaagccaag
cgctggcagccaccggaggcctcctggagccgacccttcggcctgggctgggacaagccc
tacacggttcgctatgccagcaacctcgacgacggccccaaccacggcatgccgctgggg
ggcttcggcgctggctgcttcgggcgggcgcccgacggcaacatcaacctctggcacctc
gatggcggtgagcactggtttggagtgctgcctgattgccagttcgccctgtttgaaggg
aatggtcgcggcaagcgcgcccacgccctggcggttcagccggagcaggatgcttcgcgg
ccggaggctggccagccgctgaaggtctgggagtggtacccggccagcacgccggatcgc
agcaccggcacctacgccgcccgttaccccctcagctggaccagctatgagggtgtgtac
gacgcagaggtgcgttgtgaggccttcagcccgatcctgccgggtgattaccagcgcacc
agctaccctgtggtggtgttcgtctggacgctgcgcaatcccaccgaccaacctctggat
ttgtcgttgctgctgagttggcgcaacaccactggttggttcaccaacaccgatgcctcg
gcggaggttcacttccgcgatgacggcagcccggagcacaactacgccccggccatcggc
agcaccgccggccagcgcaactgttgtattgacgatggctccctcaagggagtgttgctc
gaaggcaacgtctccgatcccgttgccgagggcgagggccagtggtgcattgccacagcc
gagcagcccggtgtgacgatccagcgctgcagccgctggaatcccagcggtgatgggcgt
gagctgtgggacagcttcagtgctgatggctctatccctgaaagcaataacgaccggcgc
agtggatcggatgatcccctcagtgctgcgcttgcggtgcagtgtcagttggcccccggg
cagagcattgagatcccgctggtgatcagctgggaccttcccgtgacggcctttgccacc
ggcagccaggcgctgcgccgctacaccgacttcttcgctgcggatgccaatcaggcggtt
gccattgccgctgaagcgctgcgtgactggcgccgttggcgccagcagatcgaggcctgg
cagcagccggtgctgcaacgccaggacctgcctaaaccgctgcggatggctctgttcaat
gagctctacgacctctgcagcggcggcagtctctggagtgcggcatcacctgaggatccc
tacggccgcttcggtgttctcgagtgcctcgactatgcctggtacgaaagcctcgatgtt
cgcctctacggatccctggccctgctccagctctggcccgaactcgacaaggccgtgctg
cgcagctttgcccgggcgattccggctgcggacgccactcagcggccgatcggctggtac
ttcacccagggcaagggccgggtggaggctgatcgcaaggtgaaaggagccaccccccac
gacctgggggctcccaacgagatcccctgggatgcgaccaactacaccgcttatcaggac
tgcaacctctggaaggacctcggcagtgattttgtgctgcaggtgtggcgcaccttcaag
ctcgcccccagtggtgaagacatccgtttcctcgccgattgctggccggcggccgtggag
gcgctgcgctacctgaagacgttcgatgtaaacaacgacggcctgcccgacaacggcggt
gctccggatcagaccttcgacgactggcccctcaaaggggtgagtgcctactgcggtgcc
ctctggattgcggctctcgaggcagcccttgccattgctcagacgcttcagctcagcacc
gggctggacacctccgctgagcaaagggaattcagcggttggctggaacaatcccggggc
aacttcgacaagctgctctggaacggcgagtactacgacattgatgccgagagcggcacg
ccggtggtgatggccgatcaactctgtggcgatttctatgcacggcttttggccctgccg
cctgtagtgagtgatgccaacagcctcagcaccttgaaggccgtgaaggaggcctgcttc
gaggctttcgatggcggttccctcggtgtggccaacggcctgcgccgcgatggcacgccg
ttggatcccaacgccacccacccgcttgaggtgtggacggggatcaacttcgggatcgcc
agttattaccgcttgatgggggacaagcagacggcgcaatcgatctgctcagcggttgtc
gagcaggtgtattccagcggtctgcagttccgcacgcctgaggcgatcaccgcggtgaac
acctaccgggcttgccactacctcagggccatggcgatctgggggctctgggccacggag
accgattggatgctcatccctggagcggatgctcgttga

  All links  
No link information was found.   
DBGET integrated database retrieval system