KEGG   Synechococcus sp. CC9605: Syncc9605_0990Help
Entry
Syncc9605_0990    CDS       T00292                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
syd  Synechococcus sp. CC9605
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:syd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Syncc9605_0990
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Syncc9605_0990
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Syncc9605_0990
Enzymes [BR:syd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Syncc9605_0990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
944001..944873
Genome map
AA seq 290 aa AA seqDB search
MRPPSTHRLSKFVPGRLTEMPNQQSSSIAQRFEQLKQDGRLALMPFLMAGDPDLAVTADV
LLSLQMAGADMVELGMPYSDPLADGPVIQAAASRALAAGTTPTGVLDMLQSLKGQLQIPV
ILFTYSNPLLNVGMEAFCQSAAEAGAAGLVVPDLPLEEAERLSTIAERHGLDLVLLVAPT
TPQDRMGRIAKCSRGFTYLVSVTGVTGERAQMESRVEGLVQQLKQTSPVPVAVGFGISGA
EQVRQVRGWGSDGAIVGSALVKRMAAASPGEIAQEAGRFCAELRAAADQP
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
gtgaggcccccgtcgactcataggctttcgaagtttgttcctggtcggttgaccgagatg
cccaatcagcagtcctcttccatcgcccagcgctttgagcagctgaagcaggacggtcgc
cttgccttgatgccattcctgatggctggcgatcctgatctcgcggtcaccgctgatgtg
cttctcagtctgcaaatggcaggggccgacatggtggaactggggatgccgtacagcgac
ccgctcgcggatgggccggtcattcaggccgctgcgtcccgtgcccttgctgccggaacc
acgccaacgggcgtgctggacatgctgcagtcgttgaagggtcagctgcagatcccggtg
atcctgttcacgtattccaatccactgctcaatgtggggatggaggcgttctgccagtct
gcagcggaggctggtgcggcgggtttggtggtgcctgatctccccctcgaggaggccgag
cggttgtcaaccatcgccgagcgtcatggcttggatttggtgctcttggttgcacccacc
actcctcaagatcggatgggtcggattgccaaatgcagccgtggtttcacctatctggtg
agtgtcactggcgtcaccggtgagcgagctcagatggaaagcagggttgaaggtttggtg
cagcaactcaaacaaacctctccggttcctgttgcggttggtttcggtatctctggggcg
gagcaggtgcgacaggttcggggctggggttccgatggagcgattgtgggcagcgcgctc
gtgaagcggatggctgcagcatcgccaggagaaattgcacaggaagctggtcgtttttgc
gctgagctgcgtgccgcggcggatcagccttaa

DBGET integrated database retrieval system