KEGG   Synechococcus sp. CC9605: Syncc9605_1025Help
Entry
Syncc9605_1025    CDS       T00292                                 

Definition
sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
syd  Synechococcus sp. CC9605
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:syd01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:syd00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:syd00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:syd00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:syd00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:syd00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
975797..976705
Genome map
AA seq 302 aa AA seqDB search
MPDVQVIGVDLGGTAIKLARIRADGTVMAEAQCPTPQPAVPGAVTMALCEAIEQIDPGHA
AQAVGIGLPGPMDASARVARVCINLPGWEDVPLADWLESRINRQVTLANDGNCAVVGEAW
LGAARGVEDVVLLTLGTGVGGGVILRGELLTGHNGAAAEPGLIGVQPDGPACNSGNRGSL
EQFASITGLRRLCDRDPRELSAEADAGDPAALEVWTLYGERLGCGVASLVYVFTPQLVLL
GGGLAGAARHFLPAVRREVESRVQAVSREGLRIEAACLGNGAGRLGAARLALQRLNGMMA
PD
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcctgacgtgcaggtgattggggtggatctcgggggaacggcgatcaagctggctcgg
attcgtgctgatggcacggtgatggccgaggctcagtgccccacaccccagcccgcggtg
cctggtgcggtgacgatggccctgtgtgaggcgatcgaacagatcgatcccgggcatgct
gctcaggcggtcggtatcggacttcccggtccgatggatgcgtcagccagggtggcccgg
gtctgcatcaacctgcccggatgggaggacgtgccactggcggattggctggagtcgagg
atcaatcgccaggtcaccctggccaatgacggcaactgtgcggttgtgggcgaagcctgg
cttggggctgcccggggtgtggaggatgtggtgctgctcaccctcggcaccggtgtggga
ggtggagtgatcttgaggggagagctgcttaccggccacaacggcgctgcagcggaacca
gggctgatcggggtgcagcccgatggtcccgcctgcaacagcggcaaccgtggctctctg
gagcagttcgccagcatcacgggcctgcggcggttgtgtgatcgcgacccccgcgagctc
agtgcggaggccgatgccggtgatcctgcggcactggaggtttggactctttacggcgag
cgcctgggctgtggtgtcgcttctttggtgtatgtgttcacgccgcagttggtgttgctg
ggtggtggcctggctggtgccgcccgccactttctgccagcggtgcgccgcgaggtggag
tcgcgggttcaggccgtctcgcgggagggcttacgcatcgaagccgcctgcctgggcaat
ggtgctggacgcctgggggcagcgcggctcgctctgcagcggctgaacgggatgatggct
ccagattga

DBGET integrated database retrieval system