KEGG   Synechococcus sp. CC9605: Syncc9605_1025Help
Entry
Syncc9605_1025    CDS       T00292                                 

Definition
sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
syd  Synechococcus sp. CC9605
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:syd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Syncc9605_1025
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Syncc9605_1025
   00052 Galactose metabolism
    Syncc9605_1025
   00500 Starch and sucrose metabolism
    Syncc9605_1025
   00520 Amino sugar and nucleotide sugar metabolism
    Syncc9605_1025
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Syncc9605_1025
   00524 Butirosin and neomycin biosynthesis
    Syncc9605_1025
Enzymes [BR:syd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Syncc9605_1025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
975797..976705
Genome map
AA seq 302 aa AA seqDB search
MPDVQVIGVDLGGTAIKLARIRADGTVMAEAQCPTPQPAVPGAVTMALCEAIEQIDPGHA
AQAVGIGLPGPMDASARVARVCINLPGWEDVPLADWLESRINRQVTLANDGNCAVVGEAW
LGAARGVEDVVLLTLGTGVGGGVILRGELLTGHNGAAAEPGLIGVQPDGPACNSGNRGSL
EQFASITGLRRLCDRDPRELSAEADAGDPAALEVWTLYGERLGCGVASLVYVFTPQLVLL
GGGLAGAARHFLPAVRREVESRVQAVSREGLRIEAACLGNGAGRLGAARLALQRLNGMMA
PD
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcctgacgtgcaggtgattggggtggatctcgggggaacggcgatcaagctggctcgg
attcgtgctgatggcacggtgatggccgaggctcagtgccccacaccccagcccgcggtg
cctggtgcggtgacgatggccctgtgtgaggcgatcgaacagatcgatcccgggcatgct
gctcaggcggtcggtatcggacttcccggtccgatggatgcgtcagccagggtggcccgg
gtctgcatcaacctgcccggatgggaggacgtgccactggcggattggctggagtcgagg
atcaatcgccaggtcaccctggccaatgacggcaactgtgcggttgtgggcgaagcctgg
cttggggctgcccggggtgtggaggatgtggtgctgctcaccctcggcaccggtgtggga
ggtggagtgatcttgaggggagagctgcttaccggccacaacggcgctgcagcggaacca
gggctgatcggggtgcagcccgatggtcccgcctgcaacagcggcaaccgtggctctctg
gagcagttcgccagcatcacgggcctgcggcggttgtgtgatcgcgacccccgcgagctc
agtgcggaggccgatgccggtgatcctgcggcactggaggtttggactctttacggcgag
cgcctgggctgtggtgtcgcttctttggtgtatgtgttcacgccgcagttggtgttgctg
ggtggtggcctggctggtgccgcccgccactttctgccagcggtgcgccgcgaggtggag
tcgcgggttcaggccgtctcgcgggagggcttacgcatcgaagccgcctgcctgggcaat
ggtgctggacgcctgggggcagcgcggctcgctctgcagcggctgaacgggatgatggct
ccagattga

DBGET integrated database retrieval system