KEGG   Synechococcus sp. CC9605: Syncc9605_1025Help
Entry
Syncc9605_1025    CDS       T00292                                 

Definition
(GenBank) ROK family sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
syd  Synechococcus sp. CC9605
Pathway
syd00010  Glycolysis / Gluconeogenesis
syd00052  Galactose metabolism
syd00500  Starch and sucrose metabolism
syd00520  Amino sugar and nucleotide sugar metabolism
syd00521  Streptomycin biosynthesis
syd01100  Metabolic pathways
syd01110  Biosynthesis of secondary metabolites
syd01120  Microbial metabolism in diverse environments
syd01130  Biosynthesis of antibiotics
syd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:syd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Syncc9605_1025
   00052 Galactose metabolism
    Syncc9605_1025
   00500 Starch and sucrose metabolism
    Syncc9605_1025
   00520 Amino sugar and nucleotide sugar metabolism
    Syncc9605_1025
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Syncc9605_1025
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Syncc9605_1025
Enzymes [BR:syd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Syncc9605_1025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: ABB34783
JGI: Syn_cc96051025
CyanoBase: Syncc9605_1025
CYORF: Syncc9605_1025
UniProt: Q3AKU9
Position
975797..976705
Genome map
AA seq 302 aa AA seqDB search
MPDVQVIGVDLGGTAIKLARIRADGTVMAEAQCPTPQPAVPGAVTMALCEAIEQIDPGHA
AQAVGIGLPGPMDASARVARVCINLPGWEDVPLADWLESRINRQVTLANDGNCAVVGEAW
LGAARGVEDVVLLTLGTGVGGGVILRGELLTGHNGAAAEPGLIGVQPDGPACNSGNRGSL
EQFASITGLRRLCDRDPRELSAEADAGDPAALEVWTLYGERLGCGVASLVYVFTPQLVLL
GGGLAGAARHFLPAVRREVESRVQAVSREGLRIEAACLGNGAGRLGAARLALQRLNGMMA
PD
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcctgacgtgcaggtgattggggtggatctcgggggaacggcgatcaagctggctcgg
attcgtgctgatggcacggtgatggccgaggctcagtgccccacaccccagcccgcggtg
cctggtgcggtgacgatggccctgtgtgaggcgatcgaacagatcgatcccgggcatgct
gctcaggcggtcggtatcggacttcccggtccgatggatgcgtcagccagggtggcccgg
gtctgcatcaacctgcccggatgggaggacgtgccactggcggattggctggagtcgagg
atcaatcgccaggtcaccctggccaatgacggcaactgtgcggttgtgggcgaagcctgg
cttggggctgcccggggtgtggaggatgtggtgctgctcaccctcggcaccggtgtggga
ggtggagtgatcttgaggggagagctgcttaccggccacaacggcgctgcagcggaacca
gggctgatcggggtgcagcccgatggtcccgcctgcaacagcggcaaccgtggctctctg
gagcagttcgccagcatcacgggcctgcggcggttgtgtgatcgcgacccccgcgagctc
agtgcggaggccgatgccggtgatcctgcggcactggaggtttggactctttacggcgag
cgcctgggctgtggtgtcgcttctttggtgtatgtgttcacgccgcagttggtgttgctg
ggtggtggcctggctggtgccgcccgccactttctgccagcggtgcgccgcgaggtggag
tcgcgggttcaggccgtctcgcgggagggcttacgcatcgaagccgcctgcctgggcaat
ggtgctggacgcctgggggcagcgcggctcgctctgcagcggctgaacgggatgatggct
ccagattga

DBGET integrated database retrieval system