KEGG   Synechococcus sp. CC9605: Syncc9605_1082Help
Entry
Syncc9605_1082    CDS       T00292                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
syd  Synechococcus sp. CC9605
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:syd00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1020343..1021533)
Genome map
AA seq 396 aa AA seqDB search
MSSPSDPSGAFQRSYPSEGMQALEKERKLPLTGWQQEVDQAKRFGLEAAESIVDRNISTF
SRGELPHFAGINTFMKAPYLEDVNQVGNYDVAIVGVPHDCGTTYRPGTRFGPQGIRRISA
LYTPYNYEMGVDLREQITLCDVGDIFTIPANNEKSFDQISKGIAHVFSSGTFPIILGGDH
SIGFPTVRGVCRHLGDKKVGIIHFDRHVDTQEIDLDERMHTCPWFHATNMANAPAENLVQ
LGIGGWQVPREGVKVCRERGTNVLTVTDITEMGLEAAAQYAIERATDGTDCVYISFDIDC
IDAGFVPGTGWPEPGGLMPREALKLLELIVRNVPVCGLEIVEVSPPYDISDMTSLMATRV
ICDTMAHLVVSGQLPRKEKPEWISDTCNMNVDQKWR
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtcatccccatcggacccttcaggggccttccagcgttcgtatcccagcgaaggcatg
caggcactcgagaaagaacgcaagcttccactcactggctggcagcaagaagttgaccag
gccaaacgcttcgggcttgaagccgccgaaagcattgttgaccgcaacatctccaccttc
tctagaggcgagctgccgcatttcgccggcatcaacaccttcatgaaggcgccctattta
gaagatgtgaaccaggtgggcaactacgacgtcgccatcgttggtgtaccccacgactgc
ggcaccacctaccggcccggaacgcgcttcggcccccaggggatccgacgaatatcagcg
ctttacaccccttacaactacgaaatgggtgtcgacctgcgtgaacagatcaccctctgc
gatgtgggtgacatcttcacgatcccggccaacaacgaaaagagcttcgatcagatctcc
aaaggcatcgcccacgtcttctcgagcggcaccttcccgatcatcctcggtggcgaccac
tcgatcggtttccccacggtgcgtggggtgtgtcgccatctcggcgacaaaaaagtggga
atcatccatttcgatcgccacgtcgacacccaggagatcgaccttgatgagcggatgcac
acctgcccttggttccatgccacaaacatggccaacgccccggcagaaaacctggtgcag
ctgggcattggtggttggcaagtgcctcgcgagggcgtcaaggtctgcagggagcggggc
accaatgtgctcacggtgaccgacatcactgaaatggggctggaagccgcagcccaatac
gccattgaacgagccaccgatggcacggactgcgtctacatctccttcgacattgactgc
atcgatgccggcttcgtgccgggaactggctggcctgagcccggtggcttgatgccgcga
gaagcgctcaagctgctcgagctgatcgtgcgcaacgttcccgtctgcggcctggaaatc
gttgaggtttcacctccctacgacatcagtgacatgacctccctgatggccacccgggtt
atttgcgacaccatggcccaccttgtggtgagcggtcagttaccccgcaaagagaagccg
gagtggatcagcgacacctgcaacatgaacgttgatcagaagtggagatag

DBGET integrated database retrieval system