KEGG   Synechococcus sp. CC9605: Syncc9605_1139Help
Entry
Syncc9605_1139    CDS       T00292                                 

Definition
(GenBank) Acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
syd  Synechococcus sp. CC9605
Pathway
syd00010  Glycolysis / Gluconeogenesis
syd00620  Pyruvate metabolism
syd00640  Propanoate metabolism
syd00680  Methane metabolism
syd01100  Metabolic pathways
syd01110  Biosynthesis of secondary metabolites
syd01120  Microbial metabolism in diverse environments
syd01130  Biosynthesis of antibiotics
syd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:syd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Syncc9605_1139
   00620 Pyruvate metabolism
    Syncc9605_1139
   00640 Propanoate metabolism
    Syncc9605_1139
  Energy metabolism
   00680 Methane metabolism
    Syncc9605_1139
Enzymes [BR:syd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Syncc9605_1139
Lipid biosynthesis proteins [BR:syd01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Syncc9605_1139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABB34894
JGI: Syn_cc96051139
CyanoBase: Syncc9605_1139
CYORF: Syncc9605_1139
UniProt: Q3AKI8
Position
1070515..1072488
Genome map
AA seq 657 aa AA seqDB search
MTDANTTIESVLQEQRVFEPPADTAAKARIGSLEAYRAMADAAKADPDAFWGEAARRELH
WFEPFHTVLDWSNPPFARWFEGGTTNLSYNCLDRHLDGPTAQKTALIWEGEPGDVRRFTY
QELHAEVCKAANGLKAMGIGKGHLVALYMPMVPEAAIAMLACARIGAPHSVVFGGFSAEA
LRDRLNDGEVKAVITADGGFRKDKPVSLKPAVDAALANGACPSVMGVLVVQRTKQDVEMV
SGRDQWWHDLVEGQSADCPAEPMASEDRLFVLYTSGSTGKPKGVVHTTAGYNLWAHLTFQ
WIFDIQYEDVFWCTADVGWITGHSYIVYGPLSNGATTVMYEGAPRPSKPGAFWELIQKHG
ITIFYTAPTAIRAFMKSGRSVPDQFDMSSLRLLGTVGEPINPEAWMWYRDVIGGNRCPIV
DTWWQTETGGVMISPLPGATPTKPGSATLPLPGIQADVIDAEGNSCGADEGGYLAVRAPW
PGMMRTVHGNPQRFRESYWEHIRPADGSYLYFAGDGARRDADGYFWVMGRVDDVINVSGH
RLGTMEIESALVSHPAVAEAAVVGRPDDLKGEGIVAFVTLEACREGDDALVKELRAHVGT
EIGPIARPDEIRCSDALPKTRSGKIMRRILRALAAGQEVSGDTSTLEDRSVLDRLRA
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacgccaacaccaccatcgaaagcgtgctgcaggagcagcgggtgttcgagccg
ccagcagacaccgccgccaaagcccgcatcggcagcctcgaggcttacagggccatggcc
gatgccgccaaagccgatcctgatgcgttctggggtgaggccgcccggcgagaactgcat
tggttcgagcccttccacaccgtgctggattggtcgaaccccccgttcgcgcgctggttt
gagggcggcaccactaacctttcctacaattgcctggaccgtcatctcgatgggccaacg
gcacagaaaacagcgttgatctgggaaggcgagccgggggatgtgcgccggttcacttac
caggaactgcatgctgaggtgtgcaaagccgccaatggcctcaaagccatgggcattggc
aagggtcaccttgtggcgctctacatgccgatggtgccggaggcggcgatcgccatgctc
gcttgtgctcgcatcggtgctccccattcagtggtgttcggtggcttttccgcagaagca
ctgagggaccgtctcaacgacggcgaagtgaaagcagtgatcaccgctgatggtggcttc
cgcaaggacaagcctgtgtcactcaagcccgcggtggatgcggcgctggccaatggagcc
tgcccctcggtgatgggcgtgcttgtggtgcagcgcaccaagcaggacgtggagatggtt
tctggtcgcgaccagtggtggcacgacttggtggagggtcagagtgccgactgccccgct
gagccgatggccagcgaggaccgcctgttcgtgctttacacctccggttccaccggcaag
cccaagggcgtggtgcacaccactgccggctacaacctttgggcccacctcaccttccag
tggatctttgatattcagtatgaggatgtcttctggtgtacggctgatgtgggttggatc
accggccacagctatatcgtctacggccccttatcgaacggtgccacgaccgtgatgtac
gagggtgcaccgcgcccgtccaagcccggtgccttctgggaattgattcagaagcacggg
atcacgatcttctacacggctcccaccgccatccgggcgttcatgaagagcggccgctcc
gtgccggatcagttcgacatgagcagccttcgcctgctgggcaccgttggcgaaccgatc
aatccggaggcctggatgtggtatcgcgacgtgattggaggcaaccgctgcccgatcgtc
gacacctggtggcagaccgaaaccggcggggtgatgatcagccccctgccgggagcaacg
cccaccaagccaggctccgccaccctgcccctgcccggcattcaggccgacgtcatcgat
gcggaagggaacagctgtggtgccgatgaaggcgggtatctggcggtgcgtgccccctgg
cccggaatgatgcgcaccgtgcatggcaaccctcaacgcttccgcgagagctattgggag
cacatccggcctgccgatgggtcttacctctatttcgcgggggacggtgcccggcgggat
gccgatggctacttctgggtgatgggccgtgtcgatgacgtgatcaacgtctcgggtcac
cgtctcggcacgatggagatcgaatcagccctcgtcagccaccccgcggtggcggaggcg
gccgtcgtgggtcgacccgacgacctcaagggcgaaggcatcgtggccttcgtcactctg
gaggcctgccgcgagggcgatgacgccctggtgaaggagctgcgagcccacgtgggaacg
gaaatcggtccgatcgcccggccggacgagatccgttgcagtgatgctctgcccaaaacc
cgcagcggcaagatcatgcgccggatcctgcgggcccttgcggcgggtcaggaggtgagt
ggcgacaccagcaccctggaggatcgctccgttctggaccgcctcagggcctga

DBGET integrated database retrieval system