KEGG   Synechococcus sp. CC9605: Syncc9605_1161Help
Entry
Syncc9605_1161    CDS       T00292                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
syd  Synechococcus sp. CC9605
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:syd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Syncc9605_1161 (ruvA)
Enzymes [BR:syd01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Syncc9605_1161 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1093099..1093743)
Genome map
AA seq 214 aa AA seqDB search
MVGWLKGLIVYKLQRGNRSQITLNCNGVGYEVQITQREWLTLENDQTIQLWIHQSISADN
WQFFGFKSTQERDIFRELISVNGVGPQAGMALMQECKSQELVEAISNGDLRRLCKAQGIG
KRTAERLAVELRASIAAFAGMDPAPSLAEGVSSEQMPESGADVEATLSMLGYDDLEVRRA
IRAIAEGSDGPPPPGDDQDAWLRGCLQWLSRDSA
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atggttggctggctcaagggtctaatcgtttacaaactacagcgaggaaatcgaagtcag
atcactctgaactgcaacggtgttggctacgaagttcaaataacacaacgtgaatggtta
accctagaaaacgatcaaacgattcaactttggattcaccagagcatcagcgcggataat
tggcaatttttcggtttcaaatcaacgcaagaacgagatattttcagagaattgatcagt
gtcaacggggttggcccgcaagcagggatggcactgatgcaggaatgcaagtcccaagaa
cttgtcgaagcgatcagcaacggcgatctacgccgactctgtaaggctcaaggcattggc
aaacgcaccgctgagcgtctggcggtggagctccgggcctccattgcggcatttgccgga
atggacccagccccttcactcgcggagggagtcagctcggaacaaatgccggagagcggg
gctgacgtcgaagcgaccctctcaatgcttgggtatgacgatcttgaagttcgtcgcgcc
attcgtgccatcgccgagggttcggacggtcccccaccccctggagacgatcaagacgcg
tggctgcgaggctgtcttcaatggttaagccgcgattcggcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system