KEGG   Synechococcus sp. CC9605: Syncc9605_1188Help
Entry
Syncc9605_1188    CDS       T00292                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
syd  Synechococcus sp. CC9605
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:syd00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Syncc9605_1188
Enzymes [BR:syd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Syncc9605_1188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1112174..1113097
Genome map
AA seq 307 aa AA seqDB search
MITVSAPAKVNLHLEVLGLRSDGFHELAMVMQSIDLADRLSFQNTADAQLSLTCDDASLS
VGDDNLILRAAQLLRDRSGFSELGASIHLEKRIPIGAGLAGGSSDGAAALVGLNALWGLG
HSTADLERMAAELGSDMPFCVAGGCQLCFGRGEQLEAVPPTPQPLAVLLVKDPTVSVSTP
WAYKRCRELKQSHYLADEAAFEQRRQALRSVDWLQPLRSDLPPPLRNDLQDVVAPETAAV
RSALDLLDSVPQSLAVAMSGSGPSCFGLFSDLASCRHAQDQLATQLERAGLKAWSCALRS
DGVRIEA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgatcacggtgtcggccccggccaaagtcaacctgcacctagaggtcctggggctgcgc
tcggacggtttccatgagctggccatggtgatgcagagcatcgacttggcggatcgcctg
agctttcagaacaccgccgatgcacaactcagcctcacctgcgatgacgccagcctcagc
gtcggcgacgacaacctgatcctccgggccgcccagttgctgcgggaccgttcgggtttt
agtgaattgggggcgtcaattcatctggagaagcgcatccctatcggtgctggcctggct
ggtggctccagcgacggcgccgcggcactggtaggtctgaatgctctgtggggcttgggc
cacagcaccgcggatctggagcgaatggccgctgagctcggttcagacatgcccttctgt
gtggccggaggatgtcagctctgcttcgggcgaggcgaacaactggaagccgtgccgcca
acgccccaacccttggcggtgctcttggtcaaagaccccacggtgagcgtctcaacgccc
tgggcctacaagcgttgccgcgagctcaagcaatcccactacctcgctgatgaggcggct
tttgaacaacgccggcaagccttgcgcagcgttgattggctccagccattgcgcagcgat
ttgccacctcctttgcgcaatgacctgcaggacgtggtggcgcccgaaacagctgcggtg
cgttcggcgctcgatttgttggacagcgttccccaaagcttggcggtggccatgagcggt
tctggacccagttgcttcgggctgttctccgatctggcgtcgtgccgccatgcgcaggat
cagcttgctacccagctggagcgtgccggcctgaaggcctggtcttgcgccctccgcagc
gatggcgtgaggatcgaggcatga

DBGET integrated database retrieval system