KEGG   Synechococcus sp. CC9605: Syncc9605_1188Help
Entry
Syncc9605_1188    CDS       T00292                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
syd  Synechococcus sp. CC9605
Pathway
syd00900  Terpenoid backbone biosynthesis
syd01100  Metabolic pathways
syd01110  Biosynthesis of secondary metabolites
syd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:syd00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Syncc9605_1188
Enzymes [BR:syd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Syncc9605_1188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ABB34943
JGI: Syn_cc96051188
CyanoBase: Syncc9605_1188
CYORF: Syncc9605_1188
UniProt: Q3AKD9
Position
1112174..1113097
Genome map
AA seq 307 aa AA seqDB search
MITVSAPAKVNLHLEVLGLRSDGFHELAMVMQSIDLADRLSFQNTADAQLSLTCDDASLS
VGDDNLILRAAQLLRDRSGFSELGASIHLEKRIPIGAGLAGGSSDGAAALVGLNALWGLG
HSTADLERMAAELGSDMPFCVAGGCQLCFGRGEQLEAVPPTPQPLAVLLVKDPTVSVSTP
WAYKRCRELKQSHYLADEAAFEQRRQALRSVDWLQPLRSDLPPPLRNDLQDVVAPETAAV
RSALDLLDSVPQSLAVAMSGSGPSCFGLFSDLASCRHAQDQLATQLERAGLKAWSCALRS
DGVRIEA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgatcacggtgtcggccccggccaaagtcaacctgcacctagaggtcctggggctgcgc
tcggacggtttccatgagctggccatggtgatgcagagcatcgacttggcggatcgcctg
agctttcagaacaccgccgatgcacaactcagcctcacctgcgatgacgccagcctcagc
gtcggcgacgacaacctgatcctccgggccgcccagttgctgcgggaccgttcgggtttt
agtgaattgggggcgtcaattcatctggagaagcgcatccctatcggtgctggcctggct
ggtggctccagcgacggcgccgcggcactggtaggtctgaatgctctgtggggcttgggc
cacagcaccgcggatctggagcgaatggccgctgagctcggttcagacatgcccttctgt
gtggccggaggatgtcagctctgcttcgggcgaggcgaacaactggaagccgtgccgcca
acgccccaacccttggcggtgctcttggtcaaagaccccacggtgagcgtctcaacgccc
tgggcctacaagcgttgccgcgagctcaagcaatcccactacctcgctgatgaggcggct
tttgaacaacgccggcaagccttgcgcagcgttgattggctccagccattgcgcagcgat
ttgccacctcctttgcgcaatgacctgcaggacgtggtggcgcccgaaacagctgcggtg
cgttcggcgctcgatttgttggacagcgttccccaaagcttggcggtggccatgagcggt
tctggacccagttgcttcgggctgttctccgatctggcgtcgtgccgccatgcgcaggat
cagcttgctacccagctggagcgtgccggcctgaaggcctggtcttgcgccctccgcagc
gatggcgtgaggatcgaggcatga

DBGET integrated database retrieval system