KEGG   Synechococcus sp. CC9605: Syncc9605_1188Help
Entry
Syncc9605_1188    CDS       T00292                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
syd  Synechococcus sp. CC9605
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:syd00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1112174..1113097
Genome map
AA seq 307 aa AA seqDB search
MITVSAPAKVNLHLEVLGLRSDGFHELAMVMQSIDLADRLSFQNTADAQLSLTCDDASLS
VGDDNLILRAAQLLRDRSGFSELGASIHLEKRIPIGAGLAGGSSDGAAALVGLNALWGLG
HSTADLERMAAELGSDMPFCVAGGCQLCFGRGEQLEAVPPTPQPLAVLLVKDPTVSVSTP
WAYKRCRELKQSHYLADEAAFEQRRQALRSVDWLQPLRSDLPPPLRNDLQDVVAPETAAV
RSALDLLDSVPQSLAVAMSGSGPSCFGLFSDLASCRHAQDQLATQLERAGLKAWSCALRS
DGVRIEA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgatcacggtgtcggccccggccaaagtcaacctgcacctagaggtcctggggctgcgc
tcggacggtttccatgagctggccatggtgatgcagagcatcgacttggcggatcgcctg
agctttcagaacaccgccgatgcacaactcagcctcacctgcgatgacgccagcctcagc
gtcggcgacgacaacctgatcctccgggccgcccagttgctgcgggaccgttcgggtttt
agtgaattgggggcgtcaattcatctggagaagcgcatccctatcggtgctggcctggct
ggtggctccagcgacggcgccgcggcactggtaggtctgaatgctctgtggggcttgggc
cacagcaccgcggatctggagcgaatggccgctgagctcggttcagacatgcccttctgt
gtggccggaggatgtcagctctgcttcgggcgaggcgaacaactggaagccgtgccgcca
acgccccaacccttggcggtgctcttggtcaaagaccccacggtgagcgtctcaacgccc
tgggcctacaagcgttgccgcgagctcaagcaatcccactacctcgctgatgaggcggct
tttgaacaacgccggcaagccttgcgcagcgttgattggctccagccattgcgcagcgat
ttgccacctcctttgcgcaatgacctgcaggacgtggtggcgcccgaaacagctgcggtg
cgttcggcgctcgatttgttggacagcgttccccaaagcttggcggtggccatgagcggt
tctggacccagttgcttcgggctgttctccgatctggcgtcgtgccgccatgcgcaggat
cagcttgctacccagctggagcgtgccggcctgaaggcctggtcttgcgccctccgcagc
gatggcgtgaggatcgaggcatga

DBGET integrated database retrieval system