KEGG   Synechococcus sp. CC9605: Syncc9605_1639Help
Entry
Syncc9605_1639    CDS       T00292                                 

Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
syd  Synechococcus sp. CC9605
Pathway
syd03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:syd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Syncc9605_1639
DNA repair and recombination proteins [BR:syd03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Syncc9605_1639
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Syncc9605_1639
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH_5 HHH_8 HHH Cdd1 IMS_HHH
Motif
Other DBs
NCBI-ProteinID: ABB35388
JGI: Syn_cc96051639
CyanoBase: Syncc9605_1639
CYORF: Syncc9605_1639
UniProt: Q3AJ44
Position
complement(1508166..1508825)
Genome map
AA seq 219 aa AA seqDB search
MTTVAADDLRNSYISRIGGRSLSGFTKPLARLIDQFERLPGIGPRTAQRLALHLLNQPQE
QIHQFADALLAARTQVGQCQTCFHLSADPECEICRNPERRNGVICVVADSRDLLALERTR
EFHGRYHVLGGLISPMDGIGPELLRVTELVQRISNEEISEVILALTPSVEGDTTSLYLGR
LLKPFCSVSRIAYGLPMGSELEYADEVTLSRALEGRRPV
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
gtgaccactgttgcggcagatgatctccgcaactcctacatttcccgcatcggcggcaga
tccctgagcggcttcaccaaaccgttggctcggctgattgatcagttcgagcgtctgccc
ggcatcggcccgcgcacggcccagcggctcgccctgcacctgttgaaccaaccgcaggag
cagatccatcagttcgctgatgctctgttggcggcccgcactcaggtgggccagtgccag
acctgcttccacctctccgccgatccagaatgtgagatttgccgcaatcccgagcgccgc
aatggcgtgatctgtgtggtggccgattcccgcgatcttttggcgctggagcgcactcgt
gaatttcatgggcgctaccacgtgctcggcggactgatctcacccatggacggcatcggc
ccggagctgctgcgcgtcaccgaattggttcaacgcatttccaacgaggagatcagtgag
gtgatcctggccctcacccccagcgtggaaggggacaccaccagcttatatctggggcgg
ttgctcaagcccttctgttcggtgagccggatcgcctatggcctgccgatgggcagtgaa
ctggaatacgccgacgaggtcaccctcagccgcgccttggaggggcgccggccggtatga

DBGET integrated database retrieval system