KEGG   Synechococcus sp. CC9605: Syncc9605_1639Help
Entry
Syncc9605_1639    CDS       T00292                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
syd  Synechococcus sp. CC9605
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:syd03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1508166..1508825)
Genome map
AA seq 219 aa AA seqDB search
MTTVAADDLRNSYISRIGGRSLSGFTKPLARLIDQFERLPGIGPRTAQRLALHLLNQPQE
QIHQFADALLAARTQVGQCQTCFHLSADPECEICRNPERRNGVICVVADSRDLLALERTR
EFHGRYHVLGGLISPMDGIGPELLRVTELVQRISNEEISEVILALTPSVEGDTTSLYLGR
LLKPFCSVSRIAYGLPMGSELEYADEVTLSRALEGRRPV
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
gtgaccactgttgcggcagatgatctccgcaactcctacatttcccgcatcggcggcaga
tccctgagcggcttcaccaaaccgttggctcggctgattgatcagttcgagcgtctgccc
ggcatcggcccgcgcacggcccagcggctcgccctgcacctgttgaaccaaccgcaggag
cagatccatcagttcgctgatgctctgttggcggcccgcactcaggtgggccagtgccag
acctgcttccacctctccgccgatccagaatgtgagatttgccgcaatcccgagcgccgc
aatggcgtgatctgtgtggtggccgattcccgcgatcttttggcgctggagcgcactcgt
gaatttcatgggcgctaccacgtgctcggcggactgatctcacccatggacggcatcggc
ccggagctgctgcgcgtcaccgaattggttcaacgcatttccaacgaggagatcagtgag
gtgatcctggccctcacccccagcgtggaaggggacaccaccagcttatatctggggcgg
ttgctcaagcccttctgttcggtgagccggatcgcctatggcctgccgatgggcagtgaa
ctggaatacgccgacgaggtcaccctcagccgcgccttggaggggcgccggccggtatga

DBGET integrated database retrieval system