KEGG   Synechococcus sp. CC9605: Syncc9605_1650Help
Entry
Syncc9605_1650    CDS       T00292                                 

Definition
DNA helicase/exodeoxyribonuclease V, alpha subunit (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
syd  Synechococcus sp. CC9605
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:syd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Syncc9605_1650
Enzymes [BR:syd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Syncc9605_1650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1517849..1519429)
Genome map
AA seq 526 aa AA seqDB search
MTELLPPGTSTWPASFTAGLHVALRRRIPPQVDGPPLEELSRDLVTALEQGELTVALTPE
RLAVAQASGWLEGDASPLLLQADRLGWRRWLQAMEQVVTELVERAHAPVPKPVKAVDPEL
SDRLNAEQCAAVRALDQASVVLLSGGPGTGKTSTVVEILARAEARHPGLRIGLAAPTGKA
ARRLGDAVLAQRAPLPCSTLHRWLEAGSRGFGRHRQRPLELDLLVIDEMSMLDLALTQVL
LEALPSGCRLLLVGDPAQLPPVGSGAVWHRLQQPDVRSRFGEGAVHLERTYRNRGALAQV
AHQLRQGDLAAFAADLAALPAQANLQVHPSPLRRFPALVRQRWLERLQLLQARTVDLNRC
SEKELMAESRPLFALLEQDLLLCPRRRGPWSLDDVHRTLLGANAAGKVERWPIGLPVICG
SNQPELGLANGDLGVVIGAGSERRLLFQVVDPDGQLQVRRLHPARLRRLEPAVALTIHRA
QGSEADRVIVLWPDPLEDGPAADHQRRLLYTAITRARASLDLVTLI
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgagttgctgcccccgggaaccagcacgtggcccgccagcttcacggctggcctc
catgtcgctctgcggcgtcggatcccgccccaagtggatggcccccctttagaggagctc
agtcgcgacctggtgacggccttggagcagggggagttgacggtggcgctgacgccggaa
cggctggccgttgcccaagccagtggctggcttgagggggatgcctcccccctgctgctt
caggctgatcggttgggctggcgccgctggttgcaggccatggagcaggtggtgaccgag
ctggtggagcgggcccacgctccggttcccaagcccgtcaaggctgtcgatcccgagctg
tcggatcgtctcaacgctgaacagtgcgctgccgtgcgcgccttggatcaggcctcggtt
gtgctgctcagcggtggtccgggtacgggcaaaaccagcacggtggtggagattctggcc
cgggcggaagcccgccatcccggcctgcgcattggtttggcggcccccaccggcaaggcg
gcccggcgcctgggggatgcggtgctggcgcaacgggctccgttgccttgcagcaccctc
caccgctggttggaggccggcagccgtggctttggcaggcaccgccagcgtcccttggag
ctggatctgctggtgatcgatgagatgtcgatgctggatctggccttgacccaggtcctg
ctcgaggcgttgcccagcggttgccggctgctgttggtgggggatccagcccaactgccg
ccggtggggagtggagcggtctggcaccggcttcagcagccggacgttcgcagtcgcttc
ggtgaaggggcggtgcacctcgagcgcacttatcgcaaccgcggtgccctggcccaggtg
gcgcaccagctgcgccagggggatctggccgcgttcgctgcggatttggctgcgttgcct
gcgcaggccaatctgcaggtgcatcccagccccctgcgtcgttttccagccttggtgcgc
cagcgctggcttgagcgcctccagctgctgcaggcgcggacggttgatctcaaccgctgc
agcgaaaaggagctgatggcggagtcccggcccttgtttgcgctgctcgagcaggatctg
ttgctctgtccacgccgccgggggccgtggagtcttgatgatgtgcaccgcacgctgctg
ggggccaatgccgccggcaaggttgagcgttggccgatcggcttgccggtgatctgcggc
agcaatcaaccggaactcggtttggccaatggcgatctcggggttgtgatcggggcaggc
tctgaacgacgcctgttgttccaggtggtggatccggatggccagctgcaggtgcgccgt
ttgcatccagctcgtttgcggcgtctggagccggcggtggcgctcaccatccatcgggct
cagggcagtgaggcggatcgggtgatcgtgctctggcccgatcccctcgaggatggcccg
gctgctgaccatcaacgccgtttgctttacacagcgatcactcgagcccgtgccagcctt
gatctggtgacgctgatctga

DBGET integrated database retrieval system