KEGG   Synechococcus sp. CC9605: Syncc9605_1746Help
Entry
Syncc9605_1746    CDS       T00292                                 

Definition
pfkB family carbohydrate kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
syd  Synechococcus sp. CC9605
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:syd00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Syncc9605_1746
Enzymes [BR:syd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Syncc9605_1746
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1597084..1597950)
Genome map
AA seq 288 aa AA seqDB search
MWRGWDSSFLEQPLSSTSALPPLRLAVVGHVEWVEFLAVDQLPHPGAIGHALRALQEPAG
GGAVVAVQMARLQQQPVQFFTALGRDSVGEACVKRLKDLGLEVHVAWREAPTRRGVSMVD
GEGDRAITVIGERLTPSLDDDLPWEALGECDGLFVTAADARLLKACRSAAVLAATPRVRL
PVLQQAGVQLDALIGSGLDPGERVEPEQLNPAPCALIRTEGAAGGLSLPGGRYDPAALPG
PLVESYGCGDSFAAGVVTALGARWSLARAIALGAQCGAACATRFGPYG
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
gtgtggagaggatgggactccagctttctggaacagccgttgtcttccacttcagcactg
ccgcctttgcgtttggccgtcgttggccatgttgagtgggtggaatttctcgcggtggat
cagctcccccatccgggggcgatcggtcatgccttgcgggccctgcaagaacctgctggt
ggtggtgctgtcgttgcggtgcagatggcacgtttgcagcaacaacccgttcagttcttt
acggctctaggtcgtgattcggtcggcgaagcctgcgtcaagaggctcaaggatctgggc
ttggaggttcatgtcgcctggagggaagcaccaacccgtcggggcgtgagcatggtcgat
ggcgagggggatcgggcgatcacagtgatcggtgagcgactgaccccatcactggatgat
gacctgccctgggaggccctcggcgaatgcgatggcctcttcgtcacggccgctgatgcg
cgtctgttgaaagcctgccgttctgctgcagttttggccgcgaccccgcgggttcgtttg
cctgtgcttcagcaggcgggggtgcaactcgatgccttgattggcagtggccttgatcca
ggtgaacgggtggagccagagcagttgaacccagctccctgtgcgctcattcgtacggaa
ggtgctgcagggggcctcagtcttccgggcggtcgttatgaccctgcagctctgcctggg
cccttggtcgagagttatggctgcggcgacagctttgcggccggggtggtcactgccctt
ggtgcgcgctggtcattggcgagggccattgccttgggtgcccagtgtggtgctgcttgt
gcgacgcgatttggaccttatggctag

DBGET integrated database retrieval system