KEGG   Synechococcus sp. CC9605: Syncc9605_1825Help
Entry
Syncc9605_1825    CDS       T00292                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
syd  Synechococcus sp. CC9605
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:syd01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:syd01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:syd00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:syd00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:syd00562]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:syd00710]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1664548..1665294
Genome map
AA seq 248 aa AA seqDB search
MGKQGVRRPVIAGNWKMHMTCAQSREFMEAFLPLIADTPDDRDLVLAPPFTALSTMAELS
RNSRVCLSSQNVHWEGQGAFTGEISPAMLKEHGVTHTIVGHSEPRKYFSESDEQINHRAR
SSQSNGLIPIVCVGESDEQRERGEAERVIRRQIEQGLEGLDAEKLVVAYEPIWAIGTGKT
CAAEEANRICGLIRSWVGSPDLVIQYGGSVKPSNIDELMGMSDIDGVLVGGASLEPESFG
RIANYQAA
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggggaagcaaggcgtgcgcagaccggtgatcgctggcaactggaagatgcacatgacc
tgtgcacagtcgcgggagttcatggaagccttcctgccattgattgctgacaccccggac
gaccgcgacctggtgctggcaccgcccttcacggccctgtcgaccatggcggaactcagc
cggaattcccgcgtctgcctgtcgagccagaacgtgcactgggaaggtcaaggtgccttc
actggagagatctccccagcgatgctcaaggagcatggtgtgacccacacaatcgtgggc
cacagcgaaccgcggaaatacttcagtgaaagtgacgagcagatcaaccaccgggccagg
tcatcccagtccaacggtctgattccgatcgtttgcgttggcgaaagcgatgagcaacga
gaacggggcgaagccgaacgggtgatccgccgccagatcgagcagggcctggagggtctc
gatgccgaaaaattagtggtggcctacgaaccgatctgggcgattggcacaggcaaaacc
tgcgctgccgaagaagccaaccgcatctgtggtctgatccgaagctgggtgggctccccc
gatctggtgattcagtacggcggctccgtcaaacccagcaacattgatgaattgatgggc
atgagcgatatcgacggggtgctggtggggggtgcttccttggagcccgaaagctttgga
cggattgccaactaccaagcggcttga

DBGET integrated database retrieval system