KEGG   Synechococcus sp. CC9605: Syncc9605_1825Help
Entry
Syncc9605_1825    CDS       T00292                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
syd  Synechococcus sp. CC9605
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:syd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Syncc9605_1825 (tpiA)
   01230 Biosynthesis of amino acids
    Syncc9605_1825 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Syncc9605_1825 (tpiA)
   00051 Fructose and mannose metabolism
    Syncc9605_1825 (tpiA)
   00562 Inositol phosphate metabolism
    Syncc9605_1825 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Syncc9605_1825 (tpiA)
Enzymes [BR:syd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Syncc9605_1825 (tpiA)
Exosome [BR:syd04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Syncc9605_1825 (tpiA)
  Exosomal proteins of bladder cancer cells
   Syncc9605_1825 (tpiA)
  Exosomal proteins of melanoma cells
   Syncc9605_1825 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1664548..1665294
Genome map
AA seq 248 aa AA seqDB search
MGKQGVRRPVIAGNWKMHMTCAQSREFMEAFLPLIADTPDDRDLVLAPPFTALSTMAELS
RNSRVCLSSQNVHWEGQGAFTGEISPAMLKEHGVTHTIVGHSEPRKYFSESDEQINHRAR
SSQSNGLIPIVCVGESDEQRERGEAERVIRRQIEQGLEGLDAEKLVVAYEPIWAIGTGKT
CAAEEANRICGLIRSWVGSPDLVIQYGGSVKPSNIDELMGMSDIDGVLVGGASLEPESFG
RIANYQAA
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggggaagcaaggcgtgcgcagaccggtgatcgctggcaactggaagatgcacatgacc
tgtgcacagtcgcgggagttcatggaagccttcctgccattgattgctgacaccccggac
gaccgcgacctggtgctggcaccgcccttcacggccctgtcgaccatggcggaactcagc
cggaattcccgcgtctgcctgtcgagccagaacgtgcactgggaaggtcaaggtgccttc
actggagagatctccccagcgatgctcaaggagcatggtgtgacccacacaatcgtgggc
cacagcgaaccgcggaaatacttcagtgaaagtgacgagcagatcaaccaccgggccagg
tcatcccagtccaacggtctgattccgatcgtttgcgttggcgaaagcgatgagcaacga
gaacggggcgaagccgaacgggtgatccgccgccagatcgagcagggcctggagggtctc
gatgccgaaaaattagtggtggcctacgaaccgatctgggcgattggcacaggcaaaacc
tgcgctgccgaagaagccaaccgcatctgtggtctgatccgaagctgggtgggctccccc
gatctggtgattcagtacggcggctccgtcaaacccagcaacattgatgaattgatgggc
atgagcgatatcgacggggtgctggtggggggtgcttccttggagcccgaaagctttgga
cggattgccaactaccaagcggcttga

DBGET integrated database retrieval system