KEGG   Synechococcus sp. CC9605: Syncc9605_1828Help
Entry
Syncc9605_1828    CDS       T00292                                 

Definition
magnesium chelatase subunit H (EC:6.6.1.2)
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
syd  Synechococcus sp. CC9605
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:syd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Syncc9605_1828
Enzymes [BR:syd01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Syncc9605_1828
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1667168..1671193)
Genome map
AA seq 1341 aa AA seqDB search
MFTQVRSADRRVAPVEGQNHKSVMKAVYVVLEPQYQNALTQAATALNASGGDLGIELCGY
LIEELRDDDNYAGFCADVAEADVFVASLIFIEDLAQKVVDAVAPHRARLKAAVVFPSMPE
VMRLNKLGSFSMAQLGQSKSAIAGFMKKRKEAGGAGFQDAMLKLLNTLPTVLKYLPVEKA
QDARSFMLSFQYWLGGTPDNLRNFLLMLADKYVFPAAEGKERPAMEVAEPEVFPDLGIWH
PLAPSMFEDLKEYLNWTSSRTDLSEEARKGPVIGLVLQRSHIVTGDDAHYVATIQELEFR
GARVIPIFCGGLDFSKPVNAFFYDPLNPEQPLVDGIVSLTGFALVGGPARQDHPKAIESL
KKLNRPYMVALPLVFQTTQEWEQSDLGLHPVQVALQIAIPELDGAIEPIVLSGRDDATGK
AHTLQDRVDAIAERSIRWSSLRIKPRTEKKLAITVFSFPPDKGNVGTAAYLDVFGSIHRV
MQEMKAKGYDVQDLPSTPRELLEAVINDADAMQGSPELSIAHRMSVEEYERLTPYSERLE
ENWGKPPGNLNSDGQNLLVFGRHFGNVFVGVQPTFGYEGDPMRLLYSRSASPHHGFAAYY
TYLQKIWKADAVLHFGTHGSLEFMPGKQMGMSETCYPDSLIGALPNLYYYAANNPSEATI
AKRRGYASTISYLTPPAENAGLYKGLKELGELVGSYQQLREGGRGIQIVNTIIETARQCN
LDKDVDLPEEDASTLELDGRDDLVGAVYRQLMEIESRLLPCGLHTIGKPPTAEEAVATLV
NIAALEREEDGLRSLPGLLAEAMGRSIEDIYKGNDEGVLADVELNRTITETSRAAIGAMV
RMLTGRDGRVSLRNSFGLFYDLLAKFGFKLPSPWLRACCTAGFVQIDSTELDKLFAYLRF
CLEQVCADMEMESLLKALDGEYILPGPGGDPIRNPGVLPSGKNIHALDPQAIPTRAAVAA
AKSVVDKLIERQREEQGTWPETIACVLWGTDNIKTYGESLAQILWFVGVKPMADSVGRVN
KLELIPLEELGRPRVDVVVNCSGVFRDLFINQMALIDQAVKMAAEADEPLEQNFVRKHAL
EQAEKEGTSLRDAACRVFSNASGSYSSNVNLAVENSTWEEEGELQEMYLSRKTFAFNADN
PGEMNQKREVFENVMKTADVTFQNLDSAEISLTDVSHYFDSDPTKLIAGLRDDGKAPTSY
IADTTTANAQVRSLSETIRLDSRTKLLNPKWYEGMLDSGYEGVREVAKRLNFTLGWSATS
GAVDNFVYEEANETFINDPEMRKRLLELNPNSFRQIVGTLLEVHGRGYWETSDENIEQLQ
ELYQEVEDRIEGVVTDRSTIN
NT seq 4026 nt NT seq  +upstreamnt  +downstreamnt
atgttcacacaggtccgctccgccgatcgccgcgttgctcctgtggagggccagaaccac
aagtccgtcatgaaggcggtttacgtggtgctggagccccaataccaaaacgccctcacc
caggcagcaacggctctcaacgcttctggtggcgatcttgggatcgagttgtgcggctat
ctgattgaagaactccgcgacgacgacaactacgccggtttctgtgccgatgtggctgaa
gctgatgtcttcgtcgcctctttgatcttcattgaagatctggcgcaaaaggttgtggac
gccgttgccccgcaccgcgcccgcctcaaggcggctgttgttttcccgtccatgcctgaa
gtcatgcggctgaacaagctgggcagcttctcgatggcccagctcggtcagagcaagagc
gccatcgcaggcttcatgaagaagcgaaaggaagccggaggtgctggcttccaggacgcg
atgctcaagctgctgaacacgctccccaccgttctcaagtacctgccggttgagaaggct
caggatgcccgcagcttcatgctcagcttccagtactggctgggcggtacccccgacaac
ctgcgcaactttctgttgatgctggctgacaagtacgtcttcccagctgcagaaggaaag
gaacgtccagccatggaggtggcggagcctgaggtgttccccgacctcggcatctggcat
cccctggctccctcgatgttcgaggacctcaaggaatatctgaactggacgtccagccgc
acagacctgtctgaggaggcccgcaaaggtccggtgatcggtttagtgctgcagcgcagc
cacatcgtcaccggtgacgatgcccactacgtagccaccatccaggagctggagttccgc
ggtgcccgcgtgattccgatcttctgcggcggtctcgacttctccaagccggtcaatgcc
tttttttacgaccccctgaatcctgagcagccgctggtggacggcatcgtctccctcacc
ggttttgcactggttggaggcccggcccgccaggaccaccccaaggcgattgagtcgctg
aagaagctcaaccgcccttacatggtggctctcccccttgtcttccagaccacccaggag
tgggaacagagcgaccttggcctgcacccggtgcaggtggctctacagatcgccataccg
gaactggatggcgccatcgagcccatcgttctctcgggccgtgacgatgccaccggcaag
gcgcacacccttcaagaccgggttgatgccattgctgagcggtccatccgctggtcatcg
ctgcggatcaagccccgcaccgaaaagaagcttgcgatcaccgtgttcagcttccctccc
gacaagggcaatgtcggcaccgcggcttacctcgacgttttcggctccatccatcgggtg
atgcaggagatgaaagcgaagggctacgacgttcaggacttgccctccacgcctcgagaa
ctgttggaggctgtcatcaatgacgccgatgccatgcagggctctcctgagctgtccatc
gcccatcggatgagcgtcgaggagtacgagcgtctgacgccttactccgaacgcctggaa
gagaactggggcaagccccccggcaacctcaacagcgatggccagaacctgctggttttc
ggtcgccacttcggcaacgtcttcgttggcgttcagcccaccttcggctacgagggtgat
ccgatgcgcttgctctattcccgcagcgccagcccccaccacggtttcgccgcttactac
acctatctgcagaagatctggaaggctgatgcggtgctgcacttcggcacccacggctcg
ctcgaattcatgcccggcaagcagatgggcatgagcgaaacctgctaccccgattcattg
atcggtgcgctgcccaacctctactactacgccgccaataacccctccgaggccaccatc
gccaagcgtcgtggttatgcctccaccatcagctacctcacccctccggctgaaaatgcc
ggtctttacaaggggctgaaggaactgggtgagctggtgggctcctaccagcagctgcgc
gagggtggccgcgggattcagatcgtcaacacgatcatcgagacggcacgtcagtgcaac
cttgataaggacgttgaccttcctgaggaggacgcctcgaccctcgaactcgatggacgc
gatgacctagtgggtgccgtctaccgccagttgatggagatcgaaagccgtctcctgccc
tgtggcttgcacaccattggcaagcctcccaccgctgaggaagctgttgccaccttggtg
aatattgctgctctcgagcgtgaggaggatggtcttcgctcactccccggcctgctggct
gaggcgatgggccgctcgatcgaagacatctacaaaggcaacgacgagggtgtactcgcc
gatgttgagctgaaccgcacgatcacggagacgtcccgcgctgccatcggcgccatggtt
cgcatgctcaccggtcgtgatggtcgggtcagcctgcgcaacagcttcggtttgttctac
gacctgcttgccaagttcggcttcaaacttccttccccgtggctgagggcctgctgcacc
gctggcttcgtgcagatcgattccacagagctcgacaagctctttgcctatctgcgcttc
tgccttgagcaggtgtgtgccgacatggagatggagagtctgctgaaggctctcgatggt
gaatacatccttccgggccccgggggtgatccgattcgcaatccaggtgtgctacccagt
ggcaagaacatccatgccctcgacccgcaggcgattcccaccagggccgcggtggctgca
gccaagagtgttgtcgacaagttgattgagcgtcagcgcgaggagcaaggcacctggccc
gaaaccatcgcctgcgtgctctggggaaccgacaacatcaagacctacggcgaatccctg
gctcagatcctctggttcgtcggcgtcaagccaatggcggactccgtgggtcgggtgaac
aagcttgagctgattccccttgaggaactcggtcgcccccgcgttgacgtggtggtgaac
tgctccggtgtgttccgcgatctgttcatcaaccagatggcgctgatcgatcaggccgtg
aagatggctgccgaggccgatgagcctctggagcagaacttcgttcgcaagcacgccctc
gagcaggcggagaaagagggtacgagcctgcgggatgcggcgtgccgggtgttttccaac
gccagcggcagctacagctccaacgtgaacctcgcggtggagaacagcacctgggaggag
gaaggtgaactgcaggagatgtacctctcccgcaagacctttgccttcaacgccgacaac
cctggtgagatgaaccagaagcgtgaggtgttcgagaacgtgatgaagacggcggatgtc
accttccagaacctcgattcggctgagatctccctcaccgatgtgagccactacttcgac
tccgaccccaccaagttgatagccggcctgcgtgatgacggcaaggctcccacaagctac
atcgccgataccaccacggccaacgctcaggtgcgctcgctgagtgaaacgattcgcctg
gattcacgcaccaagctgctgaatcccaagtggtatgaaggcatgctcgactccggctac
gagggtgtgcgagaggtggccaagcgcctcaacttcactcttggttggagtgccaccagt
ggcgccgttgacaacttcgtgtacgaagaagccaacgagaccttcattaatgacccggag
atgcgtaagcgtctgttggaactcaaccccaacagcttccgccagatcgtgggcaccctg
ctcgaagtgcatggtcgaggatactgggagacctcagacgaaaacattgagcagctgcag
gagctgtatcaggaggttgaggatcggattgagggtgttgtcaccgacagatctacgatc
aactga

DBGET integrated database retrieval system