KEGG   Synechococcus sp. CC9605: Syncc9605_2009Help
Entry
Syncc9605_2009    CDS       T00292                                 

Definition
(GenBank) putative dihydrolipoamide acetyltransferase component (E2) of pyruvate
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
syd  Synechococcus sp. CC9605
Pathway
syd00010  Glycolysis / Gluconeogenesis
syd00020  Citrate cycle (TCA cycle)
syd00620  Pyruvate metabolism
syd01100  Metabolic pathways
syd01110  Biosynthesis of secondary metabolites
syd01120  Microbial metabolism in diverse environments
syd01130  Biosynthesis of antibiotics
syd01200  Carbon metabolism
Module
syd_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:syd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Syncc9605_2009
   00020 Citrate cycle (TCA cycle)
    Syncc9605_2009
   00620 Pyruvate metabolism
    Syncc9605_2009
Enzymes [BR:syd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Syncc9605_2009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: ABB35750
JGI: Syn_cc96052009
CyanoBase: Syncc9605_2009
CYORF: Syncc9605_2009
UniProt: Q3AI32
Position
complement(1828840..1830171)
Genome map
AA seq 443 aa AA seqDB search
MATTDIFMPALSSTMTEGKIVEWLKQPGDKVARGESVLVVESDKADMDVESFQDGYLAAV
LMPAGSTAPVGETIGLIVETEAEIADAQAKAPTAPAAAAAPAPAPAPAPTPAAVQAPAPT
PAPAPAPVAAPAPSAPVVNDGRIVASPRAKKLASQMGVDLATVRGSGPHGRIQAEDVEQA
SGQPISVPRVAEGTAPAASAAGAAAAAAPAAPAGNSFGRPGETVAFNTLQGAVNKNMEAS
LAVPCFRVGYTITTDKLDAFYKQVKPKGVTMTALLAKAVAVTLARHPQVNAATTVAGMAY
PVDVNVAVAVAMEDGGLITPVLRNADRTDLYEMSRQWGDLVKRSRSKQLQPEEYSTGTFT
LSNLGMFGVDRFDAILPPGTGAILAVAASRPKVVANKDGSIAVKRQMQVNLTADHRVIYG
ADGAAFLKDLADLIENRPESLAL
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
ttggcgaccacagacatcttcatgcctgccctcagctccaccatgacggaggggaagatc
gtggagtggctgaaacagcccggagacaaggtggctcgtggggagtcggttcttgtcgtt
gagtccgacaaagcggacatggacgttgagtcattccaggacggctacctggctgcggtg
ttgatgcctgctggcagcacggcaccggtgggcgaaaccatcggtctgattgtcgaaacc
gaagctgagatcgccgacgcgcaggccaaggcccccaccgctcccgcggcggctgcagct
cccgcccctgcaccggctccggctccaacaccagctgcggtccaggccccagccccaacc
cctgcgccggctccggcacctgttgctgcccctgcaccgtcggcaccggtggtgaatgac
ggccgcatcgtggccagcccccgggcgaagaagctggcctcccagatgggtgtggacctg
gccaccgtgcgtggcagcggtccccatggccggattcaggcggaagacgttgagcaagcc
tccggtcagcccatctccgtgcctcgggtggcggaaggaacggctcccgctgcttccgcg
gctggggctgcagcagcagcagccccggcggctccggcgggcaacagctttggtcgcccc
ggcgagaccgtggcgttcaacacccttcagggtgcggtgaacaaaaacatggaggcgagc
ctggcggttccctgcttccgcgttggttacaccatcaccaccgacaagctggatgccttc
tacaaacaggtgaagcccaagggcgtcacgatgacggcactgctggccaaggcggtggcc
gtcaccctggcgcgtcatccccaggtgaatgccgccaccactgtcgctggcatggcctac
ccggtcgatgtgaacgtggctgtcgctgtggcgatggaagacggtggcttgatcacgccg
gtgctgcgcaatgccgaccgtaccgatctctatgagatgtcgcgtcagtggggtgatctg
gtcaagcgctcccgcagcaagcagctgcagccggaggaatattccacgggcaccttcacc
ctttccaacctcggcatgttcggtgttgatcgcttcgacgcgatccttcccccaggcacc
ggagccattctggccgtcgccgcatcacgcccaaaagtggtggcaaacaaggacgggtcc
atcgccgtcaagcgtcagatgcaggtcaacctgacggcggatcaccgggtgatttacggc
gctgacggcgctgcattcctgaaggatctcgccgatctgatcgagaaccgtccagaaagc
ttggcgctctga

DBGET integrated database retrieval system