KEGG   Synechococcus sp. CC9605: Syncc9605_2070Help
Entry
Syncc9605_2070    CDS       T00292                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
syd  Synechococcus sp. CC9605
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:syd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Syncc9605_2070 (hisD)
  Amino acid metabolism
   00340 Histidine metabolism
    Syncc9605_2070 (hisD)
Enzymes [BR:syd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Syncc9605_2070 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1893384..1894691
Genome map
AA seq 435 aa AA seqDB search
MSQPAVAPLRIVRDLDRAQTELKRLSSRTTQTQQGEARERVESILAAVRDRGDAAIADYT
ERFDGFRPEPMAVSPEALEQAWTSLPTNLRDALELAHRRITDFHQRQRPADLAVTGPHGE
QLGRRWRPVERAGLYVPGGRAAYPSTVLMNAVPARVAGVKNVVICSPAGRDGAVNPVVLA
AAHLAGVKTVFRLGGAQAVAAMAYGSESVPKVDVISGPGNLYVTLAKQAVYGQVAIDSLA
GPSEVLVIADHSAKPDQVAADLLAQAEHDPLAAAVLITTDPALADGINAAVAEQLADHPR
QEICEAALRDWGLVVVCDDLESCARLSDSFAPEHLELLVERPEPLADRIQNAGAIFLGPW
SPEAVGDYLAGPNHTLPTCGAARFSGALSVETFMRHTSLIGFNRAALEATGSAVQELATS
EGLHSHAESVRRRLS
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
gtgagccagccggccgttgctccccttcgcatcgtgcgggatctggaccgggcccagacg
gagctgaaacggttgtcgagccgcaccacgcaaacccagcagggtgaagcccgtgagcgg
gttgaatccattctcgcagcggtgcgcgaccgcggtgatgccgccattgccgactacacc
gaacggttcgatggcttccggcccgaaccgatggcggtgtcgcccgaggccctcgaacag
gcctggacgtcgctgccgaccaacctgcgggatgccctagagctggcccatcgccgcatc
accgacttccaccaacgccaacgtcccgccgatctggcggtgacgggcccccatggcgaa
cagcttgggcggcgctggcgaccggtggagcgggcgggtctctacgtgcccggaggacgg
gcggcctaccccagcaccgtgttgatgaatgctgttccagcccgggtcgccggcgtcaaa
aacgtggtgatctgttcccccgctggacgtgatggtgcggtgaaccccgtggtactggca
gcggcccacctggccggcgtgaaaacggtgttccgcctcggaggtgcccaagctgtcgcc
gccatggcctatggcagcgagagcgttcccaaggtggacgtgatcagtggccccgggaac
ctctacgtcaccctggcgaaacaggcggtgtacggccaggtggccatcgattccctggcg
ggaccaagcgaagtgctggtgatcgcagaccactccgccaagcccgatcaggtggcagcg
gatctgttggcgcaggcggagcacgaccccctggcggctgcggtgctgatcaccaccgac
cctgcactggccgacgggatcaacgccgcagtggccgaacagctggccgatcacccccgc
caggagatctgcgaagccgctttgcgggactgggggctggtggtggtctgcgacgacctt
gaaagctgtgcccgcctcagcgacagcttcgctcccgaacacttagagctgctggtggag
cggcccgagcccctggcggatcgcattcagaacgccggagccattttcctaggcccctgg
tctccagaagccgtgggggattacctggcaggcccgaaccacacgctgcccacctgtgga
gccgcgcgtttcagcggagccctgagtgttgagaccttcatgcgccacacctcgctgatc
ggtttcaaccgggctgccctagaagcaacgggttcagctgtgcaggagctggccaccagt
gaaggcctgcacagccacgctgagtcggtgcggcggcgcctcagctga

DBGET integrated database retrieval system