KEGG   Synechococcus sp. CC9605: Syncc9605_2418Help
Entry
Syncc9605_2418    CDS       T00292                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
syd  Synechococcus sp. CC9605
Pathway
syd00260  Glycine, serine and threonine metabolism
syd00400  Phenylalanine, tyrosine and tryptophan biosynthesis
syd01100  Metabolic pathways
syd01110  Biosynthesis of secondary metabolites
syd01130  Biosynthesis of antibiotics
syd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:syd00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Syncc9605_2418
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Syncc9605_2418
Enzymes [BR:syd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Syncc9605_2418
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABB36150
JGI: Syn_cc96052418
CyanoBase: Syncc9605_2418
CYORF: Syncc9605_2418
UniProt: Q3AGY2
Position
complement(2228215..2229471)
Genome map
AA seq 418 aa AA seqDB search
MTSTLPNASTPDPSSLQPAVRPGAHGRFGRFGGQYVPETLMPALAELEQAAAQAWNDPAF
TDELNRLLKNYVGRATPLYEAERLTAHYRRADGGPRIWLKREDLNHTGAHKINNALGQAL
LALRMGKKRIIAETGAGQHGVATATVCARFGLECVIYMGAEDMRRQALNVFRMRLLGATV
QPVTAGTATLKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMLVRDFHAVIGEESKQQC
QEAFGRLPDVLMACVGGGSNAMGLFHPFVQDMSVRLIGVEAAGDGVASGRHAATITEGRA
GVLHGAMSLLLQDGDGQVMEAHSISAGLDYPGVGPEHSYLREIGRAEYAAVTDQQALDAL
RLVSELEGIIPALETAHAFAWLEQLCPTLADGTEVVINCSGRGDKDVNTVAEKLGDQL
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
gtgaccagcaccctgcccaacgccagcactccggatccctccagcctgcagccagctgtg
cgccctggagctcatggacgctttggacggtttggcggtcagtacgtgcccgaaaccctg
atgccagccttggcggaactggagcaggctgcggctcaggcctggaacgatcccgccttc
accgatgagctcaatcgcctgctcaagaactacgtcggccgggcgacaccgttgtatgag
gccgagcgtctcaccgcccactaccgccgcgccgacggcggcccccgcatctggctgaag
cgggaagacctcaaccacaccggtgcccacaagatcaacaacgccctgggccaggcccta
ttggccctgcgcatgggcaagaagcggatcattgccgaaaccggtgcggggcagcacggc
gtcgccacggccacggtctgtgcccgcttcggtctggagtgcgtgatctacatgggcgcc
gaagacatgcgccgtcaggccctcaacgtcttccgcatgcgcctgctaggcgccacggtg
caaccggtgacggccggcaccgccaccctcaaggacgccactagtgaagcgatccgcgac
tgggtgaccaacgtcgagaccacccactacatcctgggatctgtcgctggtccgcatcct
tacccaatgttggtgcgggatttccatgctgtgatcggtgaggagtccaagcagcagtgt
caggaggcctttggccggctgcccgacgtgctgatggcctgtgttggcggaggctccaat
gccatgggcctgttccatccctttgtgcaggacatgtctgtgcggctgatcggtgttgag
gccgctggtgatggtgtggctagcggtcgccacgccgccacgatcaccgaaggtcgtgcc
ggtgtgctgcacggggccatgagcctgctgctgcaggacggcgacggtcaggtgatggag
gcccactccatcagtgcaggtctcgattaccccggagtgggaccggagcacagctacctg
cgggagatcgggcgtgctgagtacgccgcagtcaccgaccaacaggccctcgatgccctg
cgcctggtgagtgagcttgagggcatcattccagccctggaaaccgcccacgccttcgct
tggcttgagcagctttgccccaccctggccgacggcacggaagtggtcatcaactgctcc
ggccgcggcgacaaggacgtcaacaccgtggcggagaagcttggggatcagctctaa

DBGET integrated database retrieval system