KEGG   Synechococcus sp. CC9605: Syncc9605_2541Help
Entry
Syncc9605_2541    CDS       T00292                                 

Definition
Delta-9 acyl-phospholipid desaturase (EC:1.14.19.-)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
syd  Synechococcus sp. CC9605
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:syd00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Syncc9605_2541
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Syncc9605_2541
Enzymes [BR:syd01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Syncc9605_2541
Lipid biosynthesis proteins [BR:syd01004]
 Desaturase
  First
   Syncc9605_2541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2358792..2359703
Genome map
AA seq 303 aa AA seqDB search
MVSSQTADTRELRQRAAVMSPRDRLPARQRKFKMGTTSFMLVMHVLATVALLPHFWSWQG
VVAFGVLYWLTVLGVTLGLHRLVAHRSLVVPVWVERILVLMGTLACQSGPIEWVGLHRHH
HRFSDQPTDHHDAGRGLWWAHSEWMLHDIPALKELDRYAGDLQCDPFYRWLDRWFLLLQI
PLGLGLYWFGEAAQVHGGGLGLVLWAIPLRLVVVYHVTWLVNSATHAFGYRNFDCPDLSR
NCWWVALLSFGEGWHNNHHAHPASARHGLRWFEFDLTWQHVRLLKRLGLASRIRTARYVP
GAS
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
ttggtttcatcgcaaacagctgacacccgcgagcttcggcagagggccgcggtgatgtca
ccgcgcgaccgattgccggcgcgtcagcgcaaattcaagatgggaaccaccagcttcatg
ctggtgatgcacgtgctcgccaccgtggcgctgctgccgcacttctggagctggcagggc
gttgtggccttcggcgttctctattggttgacggtgctaggcgtcaccctggggttgcac
cgcctggtggcgcaccgcagcctggtggtgccggtttgggttgagcgcatcctggtactg
atgggcaccctggcctgccagagcggcccgatcgaatgggtgggtctgcaccgccatcac
caccgtttttcggatcagcccacggatcaccacgatgctggccgtggcctgtggtgggcc
cacagcgaatggatgctgcacgacatcccagccctgaaggaactcgatcgctacgccggc
gaccttcaatgcgaccccttctaccgctggctcgaccgctggttcctgctgctgcagatc
cccctgggccttgggctctattggttcggtgaagccgcccaggttcatggcggcggcctt
ggcctggtgctctgggcgattcctctccgcctcgtggtcgtgtaccacgtgacctggctg
gtgaactccgccacccacgccttcggctaccgcaatttcgattgccccgacctctcccgc
aactgctggtgggtggcactgctctctttcggtgaaggctggcacaacaaccaccacgcc
catccggccagtgcacgccatggtttgcgctggttcgagttcgatctcacctggcaacac
gtgcgcctgctcaagcgccttggactggccagccggattcgcacggcccgctacgtccct
ggagcctcctga

DBGET integrated database retrieval system