KEGG   Synechococcus sp. CC9605: Syncc9605_2591Help
Entry
Syncc9605_2591    CDS       T00292                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
syd  Synechococcus sp. CC9605
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:syd00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Syncc9605_2591
Enzymes [BR:syd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Syncc9605_2591
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2403167..2404042
Genome map
AA seq 291 aa AA seqDB search
MTAHPPSGLFDTDGTIFMGSRRNPADCRVGLFGVPYDGTTSFRPGTRFGPAAIREVSAGL
ETYCPQLNLDLEDLNFADLGAVEIPFGNPEPVLTKVKQATEAVLALGLRPLMLGGEHSIS
SGAVEAVAQRNPDLVLVQLDAHADLRDNWLGARHSHACAMRRCLEVLPSQTLFQLAIRSG
TREEFTELHESGRLMPSIDALQQALAPLQGKPIYLTVDLDWFDPSVLPGTGTPEPGGYHW
SDFASLIAMLQEHHLVAADVVELAPQLDTSGISSVLAAKVTRSLLLLLGAD
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacatccgccgagtgggctgttcgacactgacggcaccattttcatgggatcc
cggcgcaaccctgccgactgccgcgttggcctctttggtgtgccgtacgacggcaccacc
tcctttcgaccgggcacccgctttggccccgccgccatccgagaggtgagcgctggcctg
gagacctattgcccgcaactcaacctggatctggaggacctcaactttgccgatctcggt
gccgtggagattcccttcggcaaccctgagccggttctgaccaaggtgaagcaggcaacc
gaagccgtgctcgccctgggcctcaggcccctgatgctgggcggagagcattcgatcagc
tccggagccgtggaagccgtggcacaacgcaaccccgatctggtgctggtgcaactggat
gcccatgccgatctcagggacaactggctgggggcccgccacagccatgcctgcgccatg
cgccgctgtctggaggtccttcccagccagacgctgtttcagctcgcgatccgcagtggc
acgcgcgaggaattcaccgaactgcacgagagcggacggctgatgcccagcatcgatgcc
cttcaacaggcgctcgctcccttgcagggaaaacccatctatctcaccgtcgacctcgac
tggtttgacccttcagttctgccgggcacgggcacccctgaacccggtggttaccactgg
tctgacttcgccagcctgatcgcgatgctccaggagcatcacctggtggcggccgatgtg
gtggaactggccccacaactcgacaccagcggcatcagctcagtcctggccgccaaggtg
acccgcagcctgcttctcctcctcggtgccgattaa

DBGET integrated database retrieval system