KEGG   Synechococcus sp. CC9605: Syncc9605_2606Help
Entry
Syncc9605_2606    CDS       T00292                                 

Definition
alpha amylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
syd  Synechococcus sp. CC9605
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:syd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Syncc9605_2606
Enzymes [BR:syd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     Syncc9605_2606
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(2420264..2421991)
Genome map
AA seq 575 aa AA seqDB search
MQPPRDETLRTLLGDLYPVDSSGDGQELSSQLLQILSESSGDGDKAEPTERWDGRDVVLI
TYADTIGDEGGPGLQALKSFVNRHLQPFAAVIHVLPFLESTSDGGFAVASHTKLEQRFGD
WSDLAALSQGRRLMADLVLNHVSASHPWVQQFMRDEQPGRSCVLEAAPDPCWADVVRPRS
SNLFTQLRGAKGSRQVWTTFGPDQVDLNWRSVEVLLGFARLMQRMARHGVRWIRLDAVGF
VWKEPHTSCIHLPQAHQLVRVLRLLLDQVGPDGVVVTETNVPEQENLSYLRSGDEAHLAY
NFPLPPLLLEASVSGRADLLNAWLSRWPDLPPQTGLLNFTACHDGVGLRPLEGLMPQKRL
LQLLIGCEQRGGLVSHRMLSSGEEVPYEINISWWSAMADGGIDPTHLQRERFLLTQLLIL
ALPGVPAFYLPALLAAPNDLTRFRRTGHRRDLNRPQFTAQALERRLADPDSDVFALLPVL
RRALAERAVHPALHPDAPMTVLSTDRSDCVILRRSRGGETLVAVHNVTSARLSFRLRGLG
GDLNQPWADCLSGHVFEPHQSHSLEPYAVHWLVQP
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgcagcccccgcgcgacgagacgctgcggaccctgcttggcgatctgtaccccgttgat
tcttccggggatggccaggagttgtcgtcgcaattgctgcagatcttgagcgaatcgtca
ggagatggcgataaggcagaacccacggagcgctgggatggccgcgatgtggtcttgatc
acctacgccgacaccattggcgatgagggtgggcctggtcttcaagcgctgaagtcgttt
gtgaatcgccatctgcagcccttcgcagcggtgattcatgtgctgccgttcttggaatcc
accagtgacggcggttttgcggtggccagccacacgaaactcgagcagcgtttcggcgat
tggagcgaccttgctgccctctcccagggccgacggctgatggccgatctcgttcttaat
cacgtgtcggcctctcacccctgggtgcagcagttcatgcgcgatgagcagcccggccgc
tcctgtgtcctggaagcagcccccgatccctgctgggcggatgtggttcgtccgcgcagc
tcaaatctgttcacgcaattgaggggggccaaggggtcgcgacaagtctggaccaccttt
ggtccagatcaggtggatctcaactggcgcagtgtggaggtgctgctgggctttgcccgt
ctcatgcagcggatggcccggcatggggtgcgttggatccgtctggatgccgtgggtttt
gtctggaaggaaccccacacttcatgcattcatctgccgcaggcccatcaactggttcgg
gtgctgcgtctgctgctcgatcaggtgggtcccgatggcgttgtggttacggaaaccaac
gtgccggagcaggaaaatctctcctatctgaggagtggtgatgaagcgcatctcgcttac
aactttcccctgccgcccttgctgctggaggccagtgtcagtggtcgggctgacttactc
aatgcctggctgagtcgttggccagacttgccgccgcagacagggctgctcaatttcacc
gcctgtcatgacggggtcggtttaagacccctggagggtctgatgccccagaagcgcttg
ctgcagctgttgatcggctgcgagcaacggggtggactggtcagccacaggatgctcagt
tccggtgaggaggtcccttacgagatcaacatcagctggtggagtgccatggcggatggg
gggattgatcccacgcatctccaaagggagcgctttctgctcacccagctgttgatcctg
gccttgccaggtgtccctgccttctatctgccggcgttgctggcggctcccaatgatttg
actcgctttcgccgcacgggccatcgccgggatctgaatcggccccaattcacggcccag
gcgctggagcgtcgcctggcggatcccgattcagatgtcttcgcgctgctgccggtgttg
cggcgggctctggctgaacgggctgttcacccggccttgcacccggatgccccgatgacg
gtgctgagcacggaccgtagtgattgcgtcattctgcggcgctcccgtgggggggaaacg
ctggtggctgttcacaacgtcacgtcagcgcgcctcagctttcgcctcaggggcctgggt
ggtgatctgaaccagccctgggccgattgcctgagcggtcatgtgttcgaaccacatcag
tcgcattcgctagagccttatgcggtgcattggttggttcagccatga

DBGET integrated database retrieval system