KEGG   Synechococcus sp. CC9605: Syncc9605_2695Help
Entry
Syncc9605_2695    CDS       T00292                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
syd  Synechococcus sp. CC9605
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:syd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Syncc9605_2695
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Syncc9605_2695
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Syncc9605_2695
Enzymes [BR:syd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Syncc9605_2695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2509351..2510457
Genome map
AA seq 368 aa AA seqDB search
MSLFQNLRRRFTATPVMQDWPGLIEAYRSWLPVSDATPVISLREGATPLIPVPSVAEQIG
KGVKVFVKYDGLNPTGSFKDRGMTMAISKAKEAGCEAVICASTGNTSAAAAAYARRGGMR
AFVLIPDGYVAQGKLAQALVYGAEVLAIRGNFDRALDIVREAADKYPVTLVNSVNPYRLQ
GQKTAAFEIVDALGDAPDWLCIPMGNAGNITAYWMGFQEYQQAGRSRSLPRMMGFQASGS
APLVNNTTVTDPETIATAIRIGNPVNRAKALAAREASNGAFLDVTDAEILAAYKILGGQE
GIFCEPASAASVAGLLKRKDEVPAGATVVCVLTGNGLKDPDCAISNNDAAFHTDLNPDLG
TVASVMGF
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
gtgtccctgtttcagaacctccgtcggcgtttcactgccactcctgtgatgcaggactgg
cctggactgatcgaggcctatcgcagctggcttcccgtaagcgatgcgaccccggtgatc
agccttcgtgaaggcgccacccctttgatccccgttccatcggtagcggaacagatcggc
aagggcgtgaaggtgtttgtgaagtacgacggcctgaaccccacagggtccttcaaggac
cggggcatgaccatggctatcagcaaagccaaggaagccggttgtgaagcggtgatttgt
gccagcacgggcaacaccagtgctgcggctgcggcctatgccaggcggggtgggatgcgt
gcgttcgtgttgatcccggatggctatgtcgcccaggggaaactggctcaggcgctggtc
tacggggctgaggtcttggcgatccgcggcaacttcgatcgcgccctcgacatcgttcgg
gaagcggcagataagtatcccgtcaccctcgtgaactcggtgaatccctaccggctgcag
ggccagaaaaccgcggcctttgaaatcgtggatgccctcggtgatgcacccgactggctg
tgcatacccatgggcaacgccgggaacatcaccgcctattggatgggttttcaggaatat
cagcaggccggccggagccgcagcctgccccgaatgatgggattccaggccagcggatcc
gccccactggtgaacaacaccacagtgacggaccccgaaaccatcgccactgccatccgc
attggcaacccggtgaaccgagccaaggccctggcagcacgcgaggccagcaacggcgct
ttcctggatgtgaccgacgcggagatcctcgcggcctacaagattctgggcggccaggag
ggaatcttctgcgaacccgccagcgctgcctctgtggcaggcctgctcaagcgcaaagat
gaagtgcctgccggcgccacggtggtctgcgttctgaccggcaacggcctcaaggatccc
gactgcgccatcagcaacaacgacgctgcattccacaccgatctcaatcccgatttgggc
accgtcgccagcgtcatgggcttctga

DBGET integrated database retrieval system