KEGG   Synechococcus sp. CC9902: Syncc9902_0026Help
Entry
Syncc9902_0026    CDS       T00293                                 

Definition
glyceraldehyde-3-phosphate dehydrogenase, type I (EC:1.2.1.12)
Orthology
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
sye  Synechococcus sp. CC9902
Pathway
Glycolysis / Gluconeogenesis
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:sye00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Syncc9902_0026
   01230 Biosynthesis of amino acids
    Syncc9902_0026
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Syncc9902_0026
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Syncc9902_0026
Enzymes [BR:sye01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Syncc9902_0026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
26528..27553
Genome map
AA seq 341 aa AA seqDB search
MTLRVAINGFGRIGRNVLRGWISRGADTGLEIVGMNSTSDPKTSAHLLTYDSILGRLDPS
VDIQTTDDTMIINGKEIKFFADRNPLNCPWKDWGVDLVIESTGVFNTDEKASMHIQAGAK
KVILTAPGKGAGVGTFVVGVNDDQYRHEDWNILSNASCTTNCLAPIVKVLDQNFGMEWGL
MTTIHSYTGDQRILDNSHRDLRRARAAALNMVPTTTGAAKAVALVYPEVKGKLTGFAMRV
PTPNVSAVDLTFGTSKGATVEQVQAVMKEAAENGMKGIIKYSDLPLVSTDYAGTNESTIF
DADLTYAMGDKAVKILAWYDNEWGYSQRVVDLAEVVAKNWK
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgcgcgttgcgatcaatggattcggccgaattggtcgcaatgttttgcggggt
tggatcagccgtggggcagataccggtttggaaattgtggggatgaactccacatctgat
cccaagaccagtgcccacctacttacctacgactccattttggggcgtttggatccgtct
gtcgacatccaaaccactgatgacacgatgatcatcaacggcaaagagatcaaattcttt
gctgaccgcaaccccctcaattgcccatggaaggattggggcgttgacctggtgatcgaa
tccaccggtgtcttcaacactgatgaaaaagccagcatgcatatccaggctggtgccaaa
aaagtgatcctcactgctcctggtaagggcgctggtgtgggcacatttgtggtgggcgtc
aacgacgatcagtaccgccacgaggattggaacatcctcagcaacgccagctgcaccacc
aactgtctggctccaatcgtcaaagttttggatcaaaacttcggcatggagtggggtctg
atgaccaccattcacagctacaccggtgaccagcgaattctcgacaacagccaccgcgac
ctgcgtcgtgcccgtgctgctgccctgaatatggttcccaccacaactggtgctgccaag
gccgttgccttggtttatcccgaagtgaagggcaagctcaccggttttgccatgcgcgtc
cccactccaaacgtgtcggcagttgacctcaccttcggaacatccaagggagcaactgtt
gagcaagtgcaggccgtgatgaaggaggctgctgagaacggaatgaaggggatcatcaag
tacagcgatctgcccttggtttccaccgactacgccggtaccaacgagtccaccattttt
gatgccgacctcacctacgccatgggtgacaaggctgtgaagatcttggcttggtacgac
aacgagtggggttacagccagcgtgttgttgatttggctgaagtggtcgccaaaaactgg
aagtaa

DBGET integrated database retrieval system