KEGG   Synechococcus sp. CC9902: Syncc9902_0026Help
Entry
Syncc9902_0026    CDS       T00293                                 

Definition
(RefSeq) glyceraldehyde-3-phosphate dehydrogenase, type I (EC:1.2.1.12)
  KO
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
sye  Synechococcus sp. CC9902
Pathway
Glycolysis / Gluconeogenesis
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:sye00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Syncc9902_0026
   01230 Biosynthesis of amino acids
    Syncc9902_0026
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Syncc9902_0026
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Syncc9902_0026
Enzymes [BR:sye01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Syncc9902_0026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
26528..27553
Genome map
AA seq 341 aa AA seqDB search
MTLRVAINGFGRIGRNVLRGWISRGADTGLEIVGMNSTSDPKTSAHLLTYDSILGRLDPS
VDIQTTDDTMIINGKEIKFFADRNPLNCPWKDWGVDLVIESTGVFNTDEKASMHIQAGAK
KVILTAPGKGAGVGTFVVGVNDDQYRHEDWNILSNASCTTNCLAPIVKVLDQNFGMEWGL
MTTIHSYTGDQRILDNSHRDLRRARAAALNMVPTTTGAAKAVALVYPEVKGKLTGFAMRV
PTPNVSAVDLTFGTSKGATVEQVQAVMKEAAENGMKGIIKYSDLPLVSTDYAGTNESTIF
DADLTYAMGDKAVKILAWYDNEWGYSQRVVDLAEVVAKNWK
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgcgcgttgcgatcaatggattcggccgaattggtcgcaatgttttgcggggt
tggatcagccgtggggcagataccggtttggaaattgtggggatgaactccacatctgat
cccaagaccagtgcccacctacttacctacgactccattttggggcgtttggatccgtct
gtcgacatccaaaccactgatgacacgatgatcatcaacggcaaagagatcaaattcttt
gctgaccgcaaccccctcaattgcccatggaaggattggggcgttgacctggtgatcgaa
tccaccggtgtcttcaacactgatgaaaaagccagcatgcatatccaggctggtgccaaa
aaagtgatcctcactgctcctggtaagggcgctggtgtgggcacatttgtggtgggcgtc
aacgacgatcagtaccgccacgaggattggaacatcctcagcaacgccagctgcaccacc
aactgtctggctccaatcgtcaaagttttggatcaaaacttcggcatggagtggggtctg
atgaccaccattcacagctacaccggtgaccagcgaattctcgacaacagccaccgcgac
ctgcgtcgtgcccgtgctgctgccctgaatatggttcccaccacaactggtgctgccaag
gccgttgccttggtttatcccgaagtgaagggcaagctcaccggttttgccatgcgcgtc
cccactccaaacgtgtcggcagttgacctcaccttcggaacatccaagggagcaactgtt
gagcaagtgcaggccgtgatgaaggaggctgctgagaacggaatgaaggggatcatcaag
tacagcgatctgcccttggtttccaccgactacgccggtaccaacgagtccaccattttt
gatgccgacctcacctacgccatgggtgacaaggctgtgaagatcttggcttggtacgac
aacgagtggggttacagccagcgtgttgttgatttggctgaagtggtcgccaaaaactgg
aagtaa

DBGET integrated database retrieval system