KEGG   Synechococcus sp. CC9902: Syncc9902_0082Help
Entry
Syncc9902_0082    CDS       T00293                                 

Definition
(GenBank) possible photosystem II protein PsbZ (ycf9)
  KO
K02724  
photosystem II PsbZ protein
Organism
sye  Synechococcus sp. CC9902
Pathway
Photosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sye00001]
 Metabolism
  Energy metabolism
   00195 Photosynthesis
    Syncc9902_0082
Photosynthesis proteins [BR:sye00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Other common subunits
    Syncc9902_0082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
82312..82500
Genome map
AA seq 62 aa AA seqDB search
MQFLNTLTVLALVVTSFALIVAVPVLYASTEDSGRSNRLILLGGGVWVALVLLNWGMSFF
VV
NT seq 189 nt NT seq  +upstreamnt  +downstreamnt
atgcagtttctaaacactctcactgtattagccctggtggtgacgtcattcgcgttaatt
gttgctgtacctgtcctttacgcctctactgaagacagtgggcgctctaatcgtcttatt
cttttagggggtggtgtgtgggtagcgctggtattacttaattggggcatgagctttttt
gtcgtttaa

DBGET integrated database retrieval system