KEGG   Synechococcus sp. CC9902: Syncc9902_0168Help
Entry
Syncc9902_0168    CDS       T00293                                 

Definition
transketolase (EC:2.2.1.1)
Orthology
K00615  
transketolase [EC:2.2.1.1]
Organism
sye  Synechococcus sp. CC9902
Pathway
Pentose phosphate pathway
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
Oxygenic photosynthesis in plants and cyanobacteria
Class
Metabolism; Overview; Carbon metabolism [PATH:sye01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:sye01230]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:sye00030]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:sye00710]
Metabolism; Metabolism of terpenoids and polyketides; Biosynthesis of ansamycins
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(173653..175662)
Genome map
AA seq 669 aa AA seqDB search
MVAAPASLDTLCINSIRMLAVDAINKSNSGHPGLPMGCAPMGYALWDKFLNHNPKNPKWF
NRDRFVLSAGHGCMLLYALLHLTGYDSVSIDDIKQFRQWGSKTPGHPETFETPGVEVTTG
PLGAGIANAVGLAIAESHLAAKFNKPDATLVDHYTYVVMGDGCNQEGISSEACSLAGHLK
LGKLIALYDDNHITIDGRTDVSFTEDVLKRYEAYGWHVQHVADGNTDVDAISKAIAAAKA
VTDKPSIIKVTTTIGYGSPNKADTAGVHGAALGAEEAELTRKQLGWSYGPFEVPQEAYDQ
FRSAIERGASKEAEWNQTLAAYRTKFPTEAAQFERMLRGELPEGWEKSLPTYTPDDGGLA
TRKHSQICLGALGPNIPELIGGSADLTHSNYTDIKGETGSYQPESPEKRYLHFGVREHAM
AAILNGIAYHDSGLIPYGGTFLVFADYMRGSMRLSALSMLGVIYVLTHDSIGVGEDGPTH
QPIETIPSLRAMPGMLVFRPGDGNETSGAYKLAIQNRKRPSSLCLSRQGMANQANSSIDK
VALGGYVLEDCAGTPDLILIGTGTELDLCVQAAKQLTADGKKVRVVSMPCVELFDEQADA
YKEEVLPNAVRKRIVVEAAESFGWHRFIGLDGDSITMNRFGASAPGGTCLKEFGFTVDNV
VAKSKALLG
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atggtcgctgcgcccgcatccctcgacaccctctgcatcaacagcattcggatgctggcg
gtcgatgcgatcaacaagtccaacagcggccaccccggcttgcccatgggctgtgcaccg
atgggctatgcgttgtgggacaagttcctgaatcacaacccaaagaaccccaaatggttc
aaccgcgaccgcttcgtgctgtcggccggacacggctgcatgctgctgtatgcgctactg
cacctcaccggctacgactcggtgagcatcgacgacatcaagcagttccgtcagtgggga
tcgaagacccctgggcaccccgaaacctttgaaacccccggcgttgaagtgacgaccggc
cccctgggtgctggtatcgccaacgctgtgggcctcgcgattgctgaatcccacctcgcc
gccaagttcaacaagcccgacgccaccctcgtcgatcactacacctatgtggtgatgggc
gacggctgcaaccaggaaggcatttcctcggaagcctgctccctggcaggacacctcaag
ctgggcaaactgatcgccctgtacgacgacaaccacatcacgattgacggccgcaccgac
gtgtcgttcaccgaggacgtgctgaagcgctacgaagcctatggctggcatgtgcagcac
gtagcggacggaaacaccgacgtcgatgccatctccaaggcaatcgcagcggccaaggca
gtgacagataagccatcgatcatcaaggtgaccaccaccatcggctacggctcccccaac
aaagccgacaccgcaggtgttcatggtgctgctcttggcgcagaagaagctgagctcacc
cgcaagcagttgggctggagctacggccccttcgaggttccgcaggaagcctacgaccag
ttccgtagtgcaatcgagcgtggcgccagcaaagaagccgagtggaaccaaaccctcgcc
gcctaccgcactaaattccccacagaagccgcccaattcgagcggatgcttcgcggtgaa
cttcccgaaggttgggagaagagcttgccgacttacaccccagacgacggtggacttgcc
acccgcaagcactcgcagatttgcttgggtgccttaggtccgaacattcctgagttaatt
ggaggctccgcggacctcacccactccaactacaccgacatcaagggcgaaacgggctcc
tatcaacctgaatcaccggagaagcgctacttgcacttcggtgttcgcgagcatgccatg
gccgccatcctcaacggcattgcttatcacgacagtggtttgatcccctacggcggcacc
ttcttggtgtttgccgactacatgcgcggctccatgcgcctttcggccttgagcatgctg
ggtgtgatctatgtgctgacgcacgactcaatcggtgtgggagaagacggcccgacccac
cagccaatcgaaacgatcccttcactgcgggcgatgcctgggatgttggtgttccgcccc
ggagacggcaacgaaaccagcggcgcctacaagctggcgattcaaaaccgcaaacgtccc
agctcactgtgcctcagccgtcagggcatggccaaccaagccaactcgtcgatcgacaag
gttgcacttggtggttacgtgctcgaagactgcgctgggacccccgatctgatcctgatc
ggcaccggcaccgagctggacctctgcgtccaggccgctaagcagctcaccgctgatggc
aagaaggtccgcgtcgtttcaatgccttgtgtcgaactattcgacgaacaggccgatgct
tacaaggaagaggtgctccccaacgctgttcgcaaacggatcgtggtagaagcagctgaa
tcgttcggttggcaccgtttcatcggactcgatggcgacagcatcaccatgaatcgcttt
ggtgcttcagctccaggcggaacctgtttaaaggagtttgggtttactgtggacaatgtt
gtcgccaaatccaaggcgctgctgggctga

DBGET integrated database retrieval system