KEGG   Synechococcus sp. CC9902: Syncc9902_0168Help
Entry
Syncc9902_0168    CDS       T00293                                 

Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
sye  Synechococcus sp. CC9902
Pathway
sye00030  Pentose phosphate pathway
sye00710  Carbon fixation in photosynthetic organisms
sye01100  Metabolic pathways
sye01110  Biosynthesis of secondary metabolites
sye01120  Microbial metabolism in diverse environments
sye01130  Biosynthesis of antibiotics
sye01200  Carbon metabolism
sye01230  Biosynthesis of amino acids
Module
sye_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
sye_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
sye_M00165  Reductive pentose phosphate cycle (Calvin cycle)
sye_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
sye_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:sye00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Syncc9902_0168
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Syncc9902_0168
  Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    Syncc9902_0168
Enzymes [BR:sye01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     Syncc9902_0168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N DUF3429
Motif
Other DBs
NCBI-ProteinID: ABB25143
JGI: Syncc9902_0168
CyanoBase: Syncc9902_0168
CYORF: Syncc9902_0168
UniProt: Q3B0I5
Position
complement(173653..175662)
Genome map
AA seq 669 aa AA seqDB search
MVAAPASLDTLCINSIRMLAVDAINKSNSGHPGLPMGCAPMGYALWDKFLNHNPKNPKWF
NRDRFVLSAGHGCMLLYALLHLTGYDSVSIDDIKQFRQWGSKTPGHPETFETPGVEVTTG
PLGAGIANAVGLAIAESHLAAKFNKPDATLVDHYTYVVMGDGCNQEGISSEACSLAGHLK
LGKLIALYDDNHITIDGRTDVSFTEDVLKRYEAYGWHVQHVADGNTDVDAISKAIAAAKA
VTDKPSIIKVTTTIGYGSPNKADTAGVHGAALGAEEAELTRKQLGWSYGPFEVPQEAYDQ
FRSAIERGASKEAEWNQTLAAYRTKFPTEAAQFERMLRGELPEGWEKSLPTYTPDDGGLA
TRKHSQICLGALGPNIPELIGGSADLTHSNYTDIKGETGSYQPESPEKRYLHFGVREHAM
AAILNGIAYHDSGLIPYGGTFLVFADYMRGSMRLSALSMLGVIYVLTHDSIGVGEDGPTH
QPIETIPSLRAMPGMLVFRPGDGNETSGAYKLAIQNRKRPSSLCLSRQGMANQANSSIDK
VALGGYVLEDCAGTPDLILIGTGTELDLCVQAAKQLTADGKKVRVVSMPCVELFDEQADA
YKEEVLPNAVRKRIVVEAAESFGWHRFIGLDGDSITMNRFGASAPGGTCLKEFGFTVDNV
VAKSKALLG
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atggtcgctgcgcccgcatccctcgacaccctctgcatcaacagcattcggatgctggcg
gtcgatgcgatcaacaagtccaacagcggccaccccggcttgcccatgggctgtgcaccg
atgggctatgcgttgtgggacaagttcctgaatcacaacccaaagaaccccaaatggttc
aaccgcgaccgcttcgtgctgtcggccggacacggctgcatgctgctgtatgcgctactg
cacctcaccggctacgactcggtgagcatcgacgacatcaagcagttccgtcagtgggga
tcgaagacccctgggcaccccgaaacctttgaaacccccggcgttgaagtgacgaccggc
cccctgggtgctggtatcgccaacgctgtgggcctcgcgattgctgaatcccacctcgcc
gccaagttcaacaagcccgacgccaccctcgtcgatcactacacctatgtggtgatgggc
gacggctgcaaccaggaaggcatttcctcggaagcctgctccctggcaggacacctcaag
ctgggcaaactgatcgccctgtacgacgacaaccacatcacgattgacggccgcaccgac
gtgtcgttcaccgaggacgtgctgaagcgctacgaagcctatggctggcatgtgcagcac
gtagcggacggaaacaccgacgtcgatgccatctccaaggcaatcgcagcggccaaggca
gtgacagataagccatcgatcatcaaggtgaccaccaccatcggctacggctcccccaac
aaagccgacaccgcaggtgttcatggtgctgctcttggcgcagaagaagctgagctcacc
cgcaagcagttgggctggagctacggccccttcgaggttccgcaggaagcctacgaccag
ttccgtagtgcaatcgagcgtggcgccagcaaagaagccgagtggaaccaaaccctcgcc
gcctaccgcactaaattccccacagaagccgcccaattcgagcggatgcttcgcggtgaa
cttcccgaaggttgggagaagagcttgccgacttacaccccagacgacggtggacttgcc
acccgcaagcactcgcagatttgcttgggtgccttaggtccgaacattcctgagttaatt
ggaggctccgcggacctcacccactccaactacaccgacatcaagggcgaaacgggctcc
tatcaacctgaatcaccggagaagcgctacttgcacttcggtgttcgcgagcatgccatg
gccgccatcctcaacggcattgcttatcacgacagtggtttgatcccctacggcggcacc
ttcttggtgtttgccgactacatgcgcggctccatgcgcctttcggccttgagcatgctg
ggtgtgatctatgtgctgacgcacgactcaatcggtgtgggagaagacggcccgacccac
cagccaatcgaaacgatcccttcactgcgggcgatgcctgggatgttggtgttccgcccc
ggagacggcaacgaaaccagcggcgcctacaagctggcgattcaaaaccgcaaacgtccc
agctcactgtgcctcagccgtcagggcatggccaaccaagccaactcgtcgatcgacaag
gttgcacttggtggttacgtgctcgaagactgcgctgggacccccgatctgatcctgatc
ggcaccggcaccgagctggacctctgcgtccaggccgctaagcagctcaccgctgatggc
aagaaggtccgcgtcgtttcaatgccttgtgtcgaactattcgacgaacaggccgatgct
tacaaggaagaggtgctccccaacgctgttcgcaaacggatcgtggtagaagcagctgaa
tcgttcggttggcaccgtttcatcggactcgatggcgacagcatcaccatgaatcgcttt
ggtgcttcagctccaggcggaacctgtttaaaggagtttgggtttactgtggacaatgtt
gtcgccaaatccaaggcgctgctgggctga

DBGET integrated database retrieval system