KEGG   Synechococcus sp. CC9902: Syncc9902_0237Help
Entry
Syncc9902_0237    CDS       T00293                                 

Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
sye  Synechococcus sp. CC9902
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sye00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
250574..251065
Genome map
AA seq 163 aa AA seqDB search
MLRSDDLPLAIALGANLPYADAGSRQTLLMVRPLLTVVVNDWAAVPLRFSWSPLFDTTPI
GGPPDQPRYWNAVVVVHGLVATPSNEAAMRLLGELHQLESQFGRQRSSEQRWGPRTLDLD
LLFWGEHRMEHPNLVLPHPRLHLRGFVLEPLLAAMNQSSDWIA
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgctccgcagtgacgatcttcccctcgcgattgccctcggtgcgaacctgccgtatgcc
gatgctgggtcgcgacaaaccctgttgatggtgcgtccgttgttgaccgttgtggtgaac
gattgggctgcggttccactgcggttcagttggtcgccgttattcgacaccaccccgatc
ggtggtccaccggatcagccgcgctattggaacgctgtggtggtcgtgcatgggctcgtt
gcaactccatcgaatgaggcggcgatgaggttgttgggcgaattgcaccagctggaatcg
caatttgggcggcagcgatcctcggaacaacgttgggggccgcgcaccttggatctcgat
ttgttgttttggggagagcaccggatggagcatcccaacttggtgctcccccatccgcgt
cttcatctccgcggctttgtccttgagccgctgttggccgccatgaatcaatcctccgac
tggatcgcctga

DBGET integrated database retrieval system