KEGG   Synechococcus sp. CC9902: Syncc9902_0651Help
Entry
Syncc9902_0651    CDS       T00293                                 

Definition
methionine salvage pathway enzyme E-2/E-2' -like
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
sye  Synechococcus sp. CC9902
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sye00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Syncc9902_0651
Enzymes [BR:sye01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     Syncc9902_0651
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     Syncc9902_0651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
662507..663067
Genome map
AA seq 186 aa AA seqDB search
MSRLSIFPDGSTSMDQSSPTPLLVTETPAEIQAELARRGIGFEQWPALQELPLAADQSWI
LKAYANEIDRVKRDGGYATVDAIRMTPDHPERVALRSKFLAEHTHAEDEVRFFVEGRGLF
CLHLGAEVLLTLCERGDLIRVPAGTKHWFDMGGQPAFCAVRWFNNAVGWVATFTGNTISE
RFPTLD
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgtctcagcatctttccagatggatcgacgtcgatggatcagagctcgccaacg
ccgctgttggtgacggaaactcccgctgagattcaagctgaactcgcgcggcgtgggatc
ggctttgagcagtggcctgcactgcaggagttgccacttgcagcagatcagtcgtggatt
ttgaaggcctatgccaacgagattgaccgcgtgaagcgggacggcggctacgccacggtt
gatgcgattcggatgacccccgatcaccccgagcgggttgccctgcgcagcaaatttctg
gcggaacacacccatgcggaagatgaagtgcgattttttgtggaaggacggggtttgttc
tgcctgcacctcggtgcagaagtgctactcaccctgtgtgaacggggggatttgattcgg
gttccggctggaacgaagcattggtttgatatgggaggccagccagcgttctgtgctgtg
cgctggttcaacaacgcggtgggttgggtggcaacatttacggggaacacaatttctgag
cgcttccccacgttggattga

DBGET integrated database retrieval system