KEGG   Synechococcus sp. CC9902: Syncc9902_0662Help
Entry
Syncc9902_0662    CDS       T00293                                 

Definition
branched-chain alpha-keto acid dehydrogenase subunit E2
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sye  Synechococcus sp. CC9902
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sye00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Syncc9902_0662
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Syncc9902_0662
   00020 Citrate cycle (TCA cycle)
    Syncc9902_0662
   00620 Pyruvate metabolism
    Syncc9902_0662
Enzymes [BR:sye01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Syncc9902_0662
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
672042..673388
Genome map
AA seq 448 aa AA seqDB search
MATHDIFMPALSSTMTEGKIVEWLKQPGDKVARGESVLVVESDKADMDVESFQDGFLAAV
LMPAGSTAPVGETIGLIVETEAEIADAKANAPAAPAAAAAPAPTPTPAPTPAAVQASTTS
PAPAPAAPPVVTAPPVVTAPVVNDGRIVASPRAKKLASQMGVDLSTVRGSGPHGRIQAED
VEQATGQPISVPRVAEGTAPAAGGSVTSAAAPAAAAPAGNSFGRPGETVAFNTLQGAVNR
NMEASLAVPCFRVGYTITTDKLDAFYKKVKPKGVTMTALLAKAVAVTLAHHPQVNAATTA
AGMSYPADVNVAVAVAMEDGGLITPVLRQADRTDLYEMSRQWADLVKRSRSKQLLPEEYS
TGTFTLSNLGMFGVDRFDAILPPGTGAILAVAASRPMVVAGKDGSISVKRQMQVNLTADH
RVVYGADGASFLKALADLIENRPESLAL
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
ttggcaacccacgacatctttatgcctgcccttagctccaccatgacggagggcaagatc
gtcgagtggctgaaacagcctggtgacaaggtcgcccgcggcgaatcagttctggtggtg
gagtcggataaggccgacatggacgttgagtcgtttcaggatggctttctggccgcggtt
ctgatgccggctggcagcacggcaccggtgggagaaaccatcggtttgatcgttgaaacc
gaggccgagattgcagacgccaaagccaatgctccagcagctccagcggctgcggcagcc
cctgcacccacacccacgccagctcctacaccagcagcggtccaagcatcaacgacgtct
cccgctccagcccccgctgccccccctgtggtgacagcgccccctgtggtgacagccccc
gttgtgaatgacggtcgcatcgtcgccagcccccgggccaaaaagcttgcctcccaaatg
ggtgtcgacctctccacggttcgtggcagtggcccccacgggcgaatccaggccgaagat
gtggaacaggccaccgggcagcccatttcagtgccgcgggtggcggaagggacggctccc
gcggctggaggatctgtcacctcagccgcagcaccggcagcagctgccccggctggtaat
agctttggccgtcccggtgagacggttgcgttcaacaccctgcagggggctgtgaaccgc
aacatggaagccagccttgctgtgccttgcttccgcgttggttacacgatcaccaccgac
aaattggatgcgttttacaaaaaggtgaagccaaagggcgtcacgatgacggcccttttg
gccaaggcagtggccgtgacgctggcccatcatccccaggtgaatgcggcaactaccgca
gctgggatgagttatcccgctgatgtgaatgtggctgtcgctgtcgcgatggaagacggg
ggcttaattacgcctgttttgcgtcaagccgaccgcactgatctctatgagatgtctcgc
caatgggccgaccttgtgaagcgatcccgtagtaagcagcttttgcctgaggaatacagc
acgggaacgttcaccctctccaatttgggcatgtttggcgtcgaccgcttcgatgcgatc
cttcccccaggcactggagcgattttggccgtggccgcatcccgtccgatggtggtggct
ggcaaggatggctccatttcggtgaaacgtcagatgcaggtgaacctcaccgctgatcat
cgggttgtctacggcgccgatggtgcttccttcctcaaggccctggctgatttgattgag
aaccgtccggagagcttggcgctctga

DBGET integrated database retrieval system