KEGG   Synechococcus sp. CC9902: Syncc9902_0829Help
Entry
Syncc9902_0829    CDS       T00293                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
sye  Synechococcus sp. CC9902
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sye00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(830817..831596)
Genome map
AA seq 259 aa AA seqDB search
MGVINITPDSFSDGGRFLATDRAVEEAQRQLKLGADVLDLGAQSTRPGADEVGAEEECRR
LLPALTAIRRQCPEALISVDTFLAPVASAALDAGANWVNDVSGGRRDPQLLGVVAQAQCP
VVLMHSRGDSKTMDQLTDYKNITSEVRSGLQKCTEEALRAGVQPSQIIWDPGLGFAKSHE
QNLQLLRELEQLNQDGFPLLIGPSRKRFIGEVLNEPRPKARLWGTAAVACRCAQAKAAIV
RVHDVGAIAQTLRMASALW
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgggggtgatcaacatcaccccggattccttcagcgacggtggtcgatttttagcgacg
gatcgcgccgttgaggaagcgcagagacaactcaagctgggagccgatgttctcgacctc
ggggcgcaaagcacgagacccggggcggacgaagttggtgccgaggaagaatgtcgacgt
cttcttcccgcgctgaccgcaattcggcgtcagtgtcctgaggcgctgatctccgtggat
acatttttggcacccgtcgcatcagcagccctggatgcgggggcgaactgggtgaacgat
gtcagcggagggcgtcgggatcctcaactcctcggggtggtggctcaagcccaatgtccg
gttgttttgatgcacagccgcggcgacagcaagaccatggatcaactcaccgactacaag
aacatcacctccgaggtgcggtcggggttgcagaagtgcaccgaggaggcgcttcgggcg
ggagtccagccatcgcaaatcatctgggatccaggcctgggttttgccaaatcccatgag
cagaacctgcagttgctgcgtgagctcgaacagctcaatcaagacggcttcccgctgcta
atcggcccatcccgcaaacgctttattggtgaggtgcttaacgagccgcgaccgaaagcc
cgtctatggggaacagctgcggtggcctgccgctgcgctcaggccaaagcggccatcgtt
cgtgtccacgatgtgggtgcaatcgcccagacgctgcgcatggcctctgcactttggtga

DBGET integrated database retrieval system