KEGG   Synechococcus sp. CC9902: Syncc9902_0830Help
Entry
Syncc9902_0830    CDS       T00293                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sye  Synechococcus sp. CC9902
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sye00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Syncc9902_0830 (tpiA)
   01230 Biosynthesis of amino acids
    Syncc9902_0830 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Syncc9902_0830 (tpiA)
   00051 Fructose and mannose metabolism
    Syncc9902_0830 (tpiA)
   00562 Inositol phosphate metabolism
    Syncc9902_0830 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Syncc9902_0830 (tpiA)
Enzymes [BR:sye01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Syncc9902_0830 (tpiA)
Exosome [BR:sye04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Syncc9902_0830 (tpiA)
  Exosomal proteins of bladder cancer cells
   Syncc9902_0830 (tpiA)
  Exosomal proteins of melanoma cells
   Syncc9902_0830 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(831640..832371)
Genome map
AA seq 243 aa AA seqDB search
MRRPVIAGNWKMHMTCAQAREFMAAFLPLVADMPNDRDLVLAPPFTALSSMADLCKDSPI
ALSSQNVHWEGSGAFTGEISPSMLKEHGVTYTIVGHSEPRKYFSESDEQINHRARSSQAN
GLIPIVCVGETDEQRERGEAERVIRRQIEQGLEGLDADLLVVAYEPIWAIGTGKTCEAAE
ANRICGLIRSWVGSPDLVIQYGGSVKGGNIDELMGMSDIDGVLVGGASLQPDGFARIANY
NVA
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcagaccggtgatcgctggcaactggaagatgcacatgacctgtgcccaggccagg
gagttcatggctgccttcctaccgctcgtagcggacatgcccaacgaccgtgatctggtg
ctggctcctccgttcacagccctctcatccatggctgatctctgcaaggacagtcctatt
gccctttccagtcagaacgtgcactgggagggatcaggtgccttcaccggcgaaatctct
ccatccatgcttaaggagcatggagtgacctacacaatcgttggacacagcgaaccgcga
aaatatttcagtgaaagcgacgagcaaatcaatcaccgcgcccgttcatcccaggccaat
gggctgattccaatcgtctgcgtgggggagacggacgagcaacgggagcgtggtgaagca
gaacgcgtgattcgcaggcaaatcgagcaggggctggaaggactcgacgccgacctactc
gtggtggcctatgagccgatctgggccattggcactggaaaaacctgcgaagcggcagaa
gccaatcgcatatgcggcttgatccgcagctgggtggggtccccagatctcgtcattcag
tacggcggttcagtgaagggaggcaacatcgatgaactcatgggaatgagtgatattgat
ggcgttctggtgggtggcgcatcacttcaacccgatggtttcgcgcgcattgccaactac
aacgtcgcttaa

DBGET integrated database retrieval system