KEGG   Synechococcus sp. CC9902: Syncc9902_0830Help
Entry
Syncc9902_0830    CDS       T00293                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sye  Synechococcus sp. CC9902
Pathway
sye00010  Glycolysis / Gluconeogenesis
sye00051  Fructose and mannose metabolism
sye00562  Inositol phosphate metabolism
sye00710  Carbon fixation in photosynthetic organisms
sye01100  Metabolic pathways
sye01110  Biosynthesis of secondary metabolites
sye01120  Microbial metabolism in diverse environments
sye01130  Biosynthesis of antibiotics
sye01200  Carbon metabolism
sye01230  Biosynthesis of amino acids
Module
sye_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sye00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Syncc9902_0830
   00051 Fructose and mannose metabolism
    Syncc9902_0830
   00562 Inositol phosphate metabolism
    Syncc9902_0830
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Syncc9902_0830
Enzymes [BR:sye01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Syncc9902_0830
Exosome [BR:sye04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Syncc9902_0830
  Exosomal proteins of bladder cancer cells
   Syncc9902_0830
  Exosomal proteins of melanoma cells
   Syncc9902_0830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABB25796
JGI: Syncc9902_0830
CyanoBase: Syncc9902_0830
CYORF: Syncc9902_0830
UniProt: Q3AYN1
Position
complement(831640..832371)
Genome map
AA seq 243 aa AA seqDB search
MRRPVIAGNWKMHMTCAQAREFMAAFLPLVADMPNDRDLVLAPPFTALSSMADLCKDSPI
ALSSQNVHWEGSGAFTGEISPSMLKEHGVTYTIVGHSEPRKYFSESDEQINHRARSSQAN
GLIPIVCVGETDEQRERGEAERVIRRQIEQGLEGLDADLLVVAYEPIWAIGTGKTCEAAE
ANRICGLIRSWVGSPDLVIQYGGSVKGGNIDELMGMSDIDGVLVGGASLQPDGFARIANY
NVA
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcagaccggtgatcgctggcaactggaagatgcacatgacctgtgcccaggccagg
gagttcatggctgccttcctaccgctcgtagcggacatgcccaacgaccgtgatctggtg
ctggctcctccgttcacagccctctcatccatggctgatctctgcaaggacagtcctatt
gccctttccagtcagaacgtgcactgggagggatcaggtgccttcaccggcgaaatctct
ccatccatgcttaaggagcatggagtgacctacacaatcgttggacacagcgaaccgcga
aaatatttcagtgaaagcgacgagcaaatcaatcaccgcgcccgttcatcccaggccaat
gggctgattccaatcgtctgcgtgggggagacggacgagcaacgggagcgtggtgaagca
gaacgcgtgattcgcaggcaaatcgagcaggggctggaaggactcgacgccgacctactc
gtggtggcctatgagccgatctgggccattggcactggaaaaacctgcgaagcggcagaa
gccaatcgcatatgcggcttgatccgcagctgggtggggtccccagatctcgtcattcag
tacggcggttcagtgaagggaggcaacatcgatgaactcatgggaatgagtgatattgat
ggcgttctggtgggtggcgcatcacttcaacccgatggtttcgcgcgcattgccaactac
aacgtcgcttaa

DBGET integrated database retrieval system