KEGG   Synechococcus sp. CC9902: Syncc9902_0830Help
Entry
Syncc9902_0830    CDS       T00293                                 

Definition
(GenBank) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sye  Synechococcus sp. CC9902
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sye00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Syncc9902_0830
   01230 Biosynthesis of amino acids
    Syncc9902_0830
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Syncc9902_0830
   00051 Fructose and mannose metabolism
    Syncc9902_0830
   00562 Inositol phosphate metabolism
    Syncc9902_0830
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Syncc9902_0830
Enzymes [BR:sye01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Syncc9902_0830
Exosome [BR:sye04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Syncc9902_0830
  Exosomal proteins of bladder cancer cells
   Syncc9902_0830
  Exosomal proteins of melanoma cells
   Syncc9902_0830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(831640..832371)
Genome map
AA seq 243 aa AA seqDB search
MRRPVIAGNWKMHMTCAQAREFMAAFLPLVADMPNDRDLVLAPPFTALSSMADLCKDSPI
ALSSQNVHWEGSGAFTGEISPSMLKEHGVTYTIVGHSEPRKYFSESDEQINHRARSSQAN
GLIPIVCVGETDEQRERGEAERVIRRQIEQGLEGLDADLLVVAYEPIWAIGTGKTCEAAE
ANRICGLIRSWVGSPDLVIQYGGSVKGGNIDELMGMSDIDGVLVGGASLQPDGFARIANY
NVA
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcagaccggtgatcgctggcaactggaagatgcacatgacctgtgcccaggccagg
gagttcatggctgccttcctaccgctcgtagcggacatgcccaacgaccgtgatctggtg
ctggctcctccgttcacagccctctcatccatggctgatctctgcaaggacagtcctatt
gccctttccagtcagaacgtgcactgggagggatcaggtgccttcaccggcgaaatctct
ccatccatgcttaaggagcatggagtgacctacacaatcgttggacacagcgaaccgcga
aaatatttcagtgaaagcgacgagcaaatcaatcaccgcgcccgttcatcccaggccaat
gggctgattccaatcgtctgcgtgggggagacggacgagcaacgggagcgtggtgaagca
gaacgcgtgattcgcaggcaaatcgagcaggggctggaaggactcgacgccgacctactc
gtggtggcctatgagccgatctgggccattggcactggaaaaacctgcgaagcggcagaa
gccaatcgcatatgcggcttgatccgcagctgggtggggtccccagatctcgtcattcag
tacggcggttcagtgaagggaggcaacatcgatgaactcatgggaatgagtgatattgat
ggcgttctggtgggtggcgcatcacttcaacccgatggtttcgcgcgcattgccaactac
aacgtcgcttaa

DBGET integrated database retrieval system